PDB entry 5xzd

View 5xzd on RCSB PDB site
Description: Structure of acryloyl-CoA hydratase AcuH from Roseovarius nubinhibens ISM
Class: lyase
Keywords: acryloyl-CoA, hydratase, acrylate, LYASE
Deposited on 2017-07-12, released 2018-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl-coa hydratase
    Species: Roseovarius nubinhibens (strain ATCC BAA-591 / DSM 15170 / ISM) [TaxId:89187]
    Gene: ISM_05820
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xzda_
  • Chain 'B':
    Compound: enoyl-coa hydratase
    Species: Roseovarius nubinhibens (strain ATCC BAA-591 / DSM 15170 / ISM) [TaxId:89187]
    Gene: ISM_05820
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xzdb_
  • Chain 'C':
    Compound: enoyl-coa hydratase
    Species: Roseovarius nubinhibens (strain ATCC BAA-591 / DSM 15170 / ISM) [TaxId:89187]
    Gene: ISM_05820
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xzdc_
  • Chain 'D':
    Compound: enoyl-coa hydratase
    Species: Roseovarius nubinhibens (strain ATCC BAA-591 / DSM 15170 / ISM) [TaxId:89187]
    Gene: ISM_05820
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xzdd_
  • Chain 'E':
    Compound: enoyl-coa hydratase
    Species: Roseovarius nubinhibens (strain ATCC BAA-591 / DSM 15170 / ISM) [TaxId:89187]
    Gene: ISM_05820
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xzde_
  • Chain 'F':
    Compound: enoyl-coa hydratase
    Species: Roseovarius nubinhibens (strain ATCC BAA-591 / DSM 15170 / ISM) [TaxId:89187]
    Gene: ISM_05820
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xzdf_
  • Heterogens: ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xzdA (A:)
    mayetiivevedhvalitlnrpdalnalndqllselvkaledaqnndkvrcivitgseka
    faagadikmmseksfvdvfagdlfgpeaegimrirkpiiaavsgyalgggcelammcdfi
    icsdtakfgqpeinlgviagmggsqrltrfigksksmdmnltgrfmdaeeaersglvsrv
    vpakklmeetmtaaqkiaeksmiavmavkeavnrsyevplregllferrvfqslfatedq
    kegmsafaekreaqfrdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xzdA (A:)
    yetiivevedhvalitlnrpdalnalndqllselvkaledaqnndkvrcivitgsekafa
    agadikmmseksfvdvfagdlfgpeaegimrirkpiiaavsgyalgggcelammcdfiic
    sdtakfgqpeinlgviagmggsqrltrfigksksmdmnltgrfmdaeeaersglvsrvvp
    akklmeetmtaaqkiaeksmiavmavkeavnrsyevplregllferrvfqslf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xzdB (B:)
    mayetiivevedhvalitlnrpdalnalndqllselvkaledaqnndkvrcivitgseka
    faagadikmmseksfvdvfagdlfgpeaegimrirkpiiaavsgyalgggcelammcdfi
    icsdtakfgqpeinlgviagmggsqrltrfigksksmdmnltgrfmdaeeaersglvsrv
    vpakklmeetmtaaqkiaeksmiavmavkeavnrsyevplregllferrvfqslfatedq
    kegmsafaekreaqfrdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xzdB (B:)
    yetiivevedhvalitlnrpdalnalndqllselvkaledaqnndkvrcivitgsekafa
    agadvfagdlfgpeaegimrirkpiiaavsgyalgggcelammcdfiicsdtakfgqpei
    nlgviagmggsqrltrfigksksmdmnltgrfmdaeeaersglvsrvvpakklmeetmta
    aqkiaeksmiavmavkeavnrsyevplregllferrvfqslf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5xzdC (C:)
    mayetiivevedhvalitlnrpdalnalndqllselvkaledaqnndkvrcivitgseka
    faagadikmmseksfvdvfagdlfgpeaegimrirkpiiaavsgyalgggcelammcdfi
    icsdtakfgqpeinlgviagmggsqrltrfigksksmdmnltgrfmdaeeaersglvsrv
    vpakklmeetmtaaqkiaeksmiavmavkeavnrsyevplregllferrvfqslfatedq
    kegmsafaekreaqfrdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xzdC (C:)
    yetiivevedhvalitlnrpdalnalndqllselvkaledaqnndkvrcivitgsekafa
    agadvfagdlfgpeaegimrirkpiiaavsgyalgggcelammcdfiicsdtakfgqpei
    nlgviagmggsqrltrfigksksmdmnltgrfmdaeeaersglvsrvvpakklmeetmta
    aqkiaeksmiavmavkeavnrsyevplregllferrvfqslf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5xzdD (D:)
    mayetiivevedhvalitlnrpdalnalndqllselvkaledaqnndkvrcivitgseka
    faagadikmmseksfvdvfagdlfgpeaegimrirkpiiaavsgyalgggcelammcdfi
    icsdtakfgqpeinlgviagmggsqrltrfigksksmdmnltgrfmdaeeaersglvsrv
    vpakklmeetmtaaqkiaeksmiavmavkeavnrsyevplregllferrvfqslfatedq
    kegmsafaekreaqfrdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xzdD (D:)
    yetiivevedhvalitlnrpdalnalndqllselvkaledaqnndkvrcivitgsekafa
    agadvfagdlfgpeaegimrirkpiiaavsgyalgggcelammcdfiicsdtakfgqpei
    nlgviagmggsqrltrfigksksmdmnltgrfmdaeeaersglvsrvvpakklmeetmta
    aqkiaeksmiavmavkeavnrsyevplregllferrvfqslf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5xzdE (E:)
    mayetiivevedhvalitlnrpdalnalndqllselvkaledaqnndkvrcivitgseka
    faagadikmmseksfvdvfagdlfgpeaegimrirkpiiaavsgyalgggcelammcdfi
    icsdtakfgqpeinlgviagmggsqrltrfigksksmdmnltgrfmdaeeaersglvsrv
    vpakklmeetmtaaqkiaeksmiavmavkeavnrsyevplregllferrvfqslfatedq
    kegmsafaekreaqfrdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xzdE (E:)
    yetiivevedhvalitlnrpdalnalndqllselvkaledaqnndkvrcivitgsekafa
    agaagdlfgpeaegimrirkpiiaavsgyalgggcelammcdfiicsdtakfgqpeinlg
    viagmggsqrltrfigksksmdmnltgrfmdaeeaersglvsrvvpakklmeetmtaaqk
    iaeksmiavmavkeavnrsyevplregllferrvfqslf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5xzdF (F:)
    mayetiivevedhvalitlnrpdalnalndqllselvkaledaqnndkvrcivitgseka
    faagadikmmseksfvdvfagdlfgpeaegimrirkpiiaavsgyalgggcelammcdfi
    icsdtakfgqpeinlgviagmggsqrltrfigksksmdmnltgrfmdaeeaersglvsrv
    vpakklmeetmtaaqkiaeksmiavmavkeavnrsyevplregllferrvfqslfatedq
    kegmsafaekreaqfrdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xzdF (F:)
    yetiivevedhvalitlnrpdalnalndqllselvkaledaqnndkvrcivitgsekafa
    agaagdlfgpeaegimrirkpiiaavsgyalgggcelammcdfiicsdtakfgqpeinlg
    viagmggsqrltrfigksksmdmnltgrfmdaeeaersglvsrvvpakklmeetmtaaqk
    iaeksmiavmavkeavnrsyevplregllferrvfqslf