PDB entry 5xz8

View 5xz8 on RCSB PDB site
Description: Crystal Structure of Phosphofructokinase from Staphylococcus aureus in complex with adenylylimidodiphosphate (the ATP analog) and fructose-6-phosphate
Class: transferase
Keywords: Phosphofructokinase, Staphylococcus aureus, Fructose-6-phosphate, TRANSFERASE
Deposited on 2017-07-11, released 2019-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent 6-phosphofructokinase
    Species: Staphylococcus aureus subsp. aureus ST228 [TaxId:1074919]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xz8a_
  • Heterogens: F6P, GOL, MG, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xz8A (A:)
    mkkiavltsggdspgmnaavravvrtaiyneievygvyhgyqgllnddihklelgsvgdt
    iqrggtflysarcpefkeqevrkvaienlrkrgieglvviggdgsyrgaqriseeckeiq
    tigipgtidndingtdftigfdtalntiiglvdkirdtasshartfiieamgrdcgdlal
    waglsvgaetivvpevktdikeiadkieqgikrgkkhsivlvaegcmtaqdcqkelsqyi
    nvdnrvsvlghvqrggsptgadrvlasrlggyavdllmqgetakgvgiknnkivatsfde
    ifdgkdhkfdyslyelanklsilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xz8A (A:)
    mkkiavltsggdspgmnaavravvrtaiyneievygvyhgyqgllnddihklelgsvgdt
    iqrggtflysarcpefkeqevrkvaienlrkrgieglvviggdgsyrgaqriseeckeiq
    tigipgtidndingtdftigfdtalntiiglvdkirdtasshartfiieamgrdcgdlal
    waglsvgaetivvpevktdikeiadkieqgikrgkkhsivlvaegcmtaqdcqkelsqyi
    nvdnrvsvlghvqrggsptgadrvlasrlggyavdllmqgetakgvgiknnkivatsfde
    ifdkfdyslyelankls