PDB entry 5xz7

View 5xz7 on RCSB PDB site
Description: Crystal Structure of Phosphofructokinase from Staphylococcus aureus in complex with adenylylimidodiphosphate, the ATP analogue
Class: transferase
Keywords: Phosphofructokinase, Staphylococcus aureus, TRANSFERASE
Deposited on 2017-07-11, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent 6-phosphofructokinase
    Species: Staphylococcus aureus subsp. aureus ST228 [TaxId:1074919]
    Gene: pfkA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0D1I869 (0-321)
      • expression tag (322-325)
    Domains in SCOPe 2.07: d5xz7a1, d5xz7a2
  • Heterogens: GOL, F6P, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xz7A (A:)
    mkkiavltsggdspgmnaavravvrtaiyneievygvyhgyqgllnddihklelgsvgdt
    iqrggtflysarcpefkeqevrkvaienlrkrgieglvviggdgsyrgaqriseeckeiq
    tigipgtidndingtdftigfdtalntiiglvdkirdtasshartfiieamgrdcgdlal
    waglsvgaetivvpevktdikeiadkieqgikrgkkhsivlvaegcmtaqdcqkelsqyi
    nvdnrvsvlghvqrggsptgadrvlasrlggyavdllmqgetakgvgiknnkivatsfde
    ifdgkdhkfdyslyelanklsilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xz7A (A:)
    mkkiavltsggdspgmnaavravvrtaiyneievygvyhgyqgllnddihklelgsvgdt
    iqrggtflysarcpefkeqevrkvaienlrkrgieglvviggdgsyrgaqriseeckeiq
    tigipgtidndingtdftigfdtalntiiglvdkirdtasshartfiieamgrdcgdlal
    waglsvgaetivvpevktdikeiadkieqgikrgkkhsivlvaegcmtaqdcqkelsqyi
    nvdnrvsvlghvqrggsptgadrvlasrlggyavdllmqgetakgvgiknnkivatsfde
    ifdkfdyslyelanklsilehh