PDB entry 5xz5

View 5xz5 on RCSB PDB site
Description: Purification,crystallization and structural analysis of cytoplastic acetoacetyl-CoA thiolase from Saccharomyces cerevisiae
Class: transferase
Keywords: Acetoacetyl-CoA thiolase, Claisen condension, The mevalonate pathway, TRANSFERASE
Deposited on 2017-07-11, released 2018-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetyl-CoA acetyltransferase
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: ERG10, YPL028W, LPB3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xz5a1, d5xz5a2
  • Chain 'B':
    Compound: Acetyl-CoA acetyltransferase
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: ERG10, YPL028W, LPB3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xz5b1, d5xz5b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xz5A (A:)
    mghhhhhhgshmsqnvyivstartpigsfqgslssktavelgavalkgalakvpeldask
    dfdeiifgnvlsanlgqaparqvalaaglsnhivastvnkvcasamkaiilgaqsikcgn
    advvvaggcesmtnapyympaaragakfgqtvlvdgverdglndaydglamgvhaekcar
    dwditreqqdnfaiesyqksqksqkegkfdneivpvtikgfrgkpdtqvtkdeeparlhv
    eklrsartvfqkengtvtaanaspindgaaavilvsekvlkeknlkplaiikgwgeaahq
    padftwapslavpkalkhagiedinsvdyfefneafsvvglvntkilkldpskvnvygga
    valghplgcsgarvvvtllsilqqeggkigvaaicnggggassivieki
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xz5A (A:)
    sqnvyivstartpigsfqgslssktavelgavalkgalakvpeldaskdfdeiifgnvls
    anlgqaparqvalaaglsnhivastvnkvcasamkaiilgaqsikcgnadvvvaggcesm
    tnapyympaaragakfgqtvlvdgverdglndaydglamgvhaekcardwditreqqdnf
    aiesyqksqksqkegkfdneivpvtikgfrgkpdtqvtkdeeparlhveklrsaspindg
    aaavilvsekvlkeknlkplaiikgwgeaahqpadftwapslavpkalkhagiedinsvd
    yfefneafsvvglvntkilkldpskvnvyggavalghplgcsgarvvvtllsilqqeggk
    igvaaicnggggassivieki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xz5B (B:)
    mghhhhhhgshmsqnvyivstartpigsfqgslssktavelgavalkgalakvpeldask
    dfdeiifgnvlsanlgqaparqvalaaglsnhivastvnkvcasamkaiilgaqsikcgn
    advvvaggcesmtnapyympaaragakfgqtvlvdgverdglndaydglamgvhaekcar
    dwditreqqdnfaiesyqksqksqkegkfdneivpvtikgfrgkpdtqvtkdeeparlhv
    eklrsartvfqkengtvtaanaspindgaaavilvsekvlkeknlkplaiikgwgeaahq
    padftwapslavpkalkhagiedinsvdyfefneafsvvglvntkilkldpskvnvygga
    valghplgcsgarvvvtllsilqqeggkigvaaicnggggassivieki
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xz5B (B:)
    qnvyivstartpigsfqgslssktavelgavalkgalakvpeldaskdfdeiifgnvlsa
    nlgqaparqvalaaglsnhivastvnkvcasamkaiilgaqsikcgnadvvvaggcesmt
    napyympaaragakfgqtvlvdgverdglndaydglamgvhaekcardwditreqqdnfa
    iesyqksqksqkegkfdneivpvtikgfrgkpdtqvtkdeeparlhveklrsartvfqke
    ngtvtaanaspindgaaavilvsekvlkeknlkplaiikgwgeaahqpadftwapslavp
    kalkhagiedinsvdyfefneafsvvglvntkilkldpskvnvyggavalghplgcsgar
    vvvtllsilqqeggkigvaaicnggggassivieki