PDB entry 5xz2

View 5xz2 on RCSB PDB site
Description: Crystal structure of adenylate kinase
Class: transferase
Keywords: phosphorylation, TRANSFERASE
Deposited on 2017-07-11, released 2018-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylate kinase isoenzyme 1
    Species: Danio rerio [TaxId:7955]
    Gene: ak1, AK1, zgc:91930
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xz2a_
  • Chain 'B':
    Compound: adenylate kinase isoenzyme 1
    Species: Danio rerio [TaxId:7955]
    Gene: ak1, AK1, zgc:91930
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xz2b_
  • Heterogens: AP5, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xz2A (A:)
    ghmadkiknakivfvvggpgsgkgtqcekivakygythlssgdllraevasgsergkqlq
    aimqkgelvpldtvldmikdamiakadvskgylidgyprevkqgeefekkigapalllyi
    dakgetmvkrlmkrgetsgraddneetikkrldlyykatepviafyeqrgivrkinselp
    vdevfaivekaidelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xz2A (A:)
    adkiknakivfvvggpgsgkgtqcekivakygythlssgdllraevasgsergkqlqaim
    qkgelvpldtvldmikdamiakadvskgylidgyprevkqgeefekkigapalllyidak
    getmvkrlmkrgetsgraddneetikkrldlyykatepviafyeqrgivrkinselpvde
    vfaivekaidel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xz2B (B:)
    ghmadkiknakivfvvggpgsgkgtqcekivakygythlssgdllraevasgsergkqlq
    aimqkgelvpldtvldmikdamiakadvskgylidgyprevkqgeefekkigapalllyi
    dakgetmvkrlmkrgetsgraddneetikkrldlyykatepviafyeqrgivrkinselp
    vdevfaivekaidelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xz2B (B:)
    adkiknakivfvvggpgsgkgtqcekivakygythlssgdllraevasgsergkqlqaim
    qkgelvpldtvldmikdamiakadvskgylidgyprevkqgeefekkigapalllyidak
    getmvkrlmkrgetsgraddneetikkrldlyykatepviafyeqrgivrkinselpvde
    vfaivekaidel