PDB entry 5xyy

View 5xyy on RCSB PDB site
Description: The structure of p38 alpha in complex with a triazol inhibitor
Class: transferase/transferase inhibitor
Keywords: p38 MAP kinase, Transferase, Transferase-Transferase inhibitor complex
Deposited on 2017-07-11, released 2018-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-01-17, with a file datestamp of 2018-01-12.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2, SAPK2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xyya_
  • Heterogens: P0F

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xyyA (A:)
    mgsshhhhhhssglvprgshmsqerptfyrqelnktiwevperyqnlspvgsgaygsvca
    afdtktglrvavkklsrpfqsiihakrtyrelrllkhmkhenviglldvftparsleefn
    dvylvthlmgadlnnivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavne
    dcelkildfglarhtddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgr
    tlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganpl
    avdllekmlvldsdkritaaqalahayfaqyhdpddepvadpydqsfesrdllidewksl
    tydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xyyA (A:)
    erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsii
    hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
    ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyv
    atrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpg
    aellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqal
    ahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppl