PDB entry 5xyl

View 5xyl on RCSB PDB site
Description: Solution Structure of Skp1 from Homo sapiens
Class: cell cycle
Keywords: Fbox interacting protein, CELL CYCLE
Deposited on 2017-07-09, released 2018-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S-phase kinase-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SKP1, EMC19, OCP2, SKP1A, TCEB1L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xyla1, d5xyla2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5xylA (A:)
mpsiklqssdgeifevdveiakqsvtiktmledlgmddegdddpvplpnvnaailkkviq
wcthhkddppppeddenkekrtddipvwdqeflkvdqgtlfelilaanyldikglldvtc
ktvanmikgktpeeirktfnikndfteeeeaqvrkenqwceek