PDB entry 5xxh

View 5xxh on RCSB PDB site
Description: Crystal Structure Analysis of the CBP
Class: transferase
Keywords: CBP, Bromodomain, TRANSFERASE
Deposited on 2017-07-04, released 2018-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xxha_
  • Heterogens: E0D, EDO, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xxhA (A:)
    mkkghhhhhhlvprgsrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipd
    yfdivknpmdlstikrkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaev
    feqeidpvmqslg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xxhA (A:)
    rkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikr
    kldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg