PDB entry 5xx9

View 5xx9 on RCSB PDB site
Description: Crystal structure of Bacterioferritin
Class: metal transport
Keywords: Bacterioferritin, METAL TRANSPORT
Deposited on 2017-07-01, released 2018-07-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterioferritin
    Species: Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) [TaxId:100226]
    Gene: bfr, SCO2113, SC6E10.07
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5xx9a_
  • Chain 'B':
    Compound: bacterioferritin
    Species: Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) [TaxId:100226]
    Gene: bfr, SCO2113, SC6E10.07
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5xx9b_
  • Chain 'C':
    Compound: bacterioferritin
    Species: Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) [TaxId:100226]
    Gene: bfr, SCO2113, SC6E10.07
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5xx9c_
  • Chain 'D':
    Compound: bacterioferritin
    Species: Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) [TaxId:100226]
    Gene: bfr, SCO2113, SC6E10.07
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5xx9d_
  • Chain 'E':
    Compound: bacterioferritin
    Species: Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) [TaxId:100226]
    Gene: bfr, SCO2113, SC6E10.07
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5xx9e_
  • Chain 'F':
    Compound: bacterioferritin
    Species: Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) [TaxId:100226]
    Gene: bfr, SCO2113, SC6E10.07
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5xx9f_
  • Heterogens: FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xx9A (A:)
    mqgdpevieflneqltaeltainqyflhaklqdhkgwtklakytraesfdemrhaevltd
    rillldglpnyqrlfhvrvgqsvtemfqadreveleaidrlrrgievmrakhditsanvf
    eailadeehhidyletqldlieklgeslylstvieqtqpdpsgpgsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xx9A (A:)
    mqgdpevieflneqltaeltainqyflhaklqdhkgwtklakytraesfdemrhaevltd
    rillldglpnyqrlfhvrvgqsvtemfqadreveleaidrlrrgievmrakhditsanvf
    eailadeehhidyletqldlieklgeslylstvieqtqpdps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xx9B (B:)
    mqgdpevieflneqltaeltainqyflhaklqdhkgwtklakytraesfdemrhaevltd
    rillldglpnyqrlfhvrvgqsvtemfqadreveleaidrlrrgievmrakhditsanvf
    eailadeehhidyletqldlieklgeslylstvieqtqpdpsgpgsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xx9B (B:)
    mqgdpevieflneqltaeltainqyflhaklqdhkgwtklakytraesfdemrhaevltd
    rillldglpnyqrlfhvrvgqsvtemfqadreveleaidrlrrgievmrakhditsanvf
    eailadeehhidyletqldlieklgeslylstvieqt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5xx9C (C:)
    mqgdpevieflneqltaeltainqyflhaklqdhkgwtklakytraesfdemrhaevltd
    rillldglpnyqrlfhvrvgqsvtemfqadreveleaidrlrrgievmrakhditsanvf
    eailadeehhidyletqldlieklgeslylstvieqtqpdpsgpgsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xx9C (C:)
    mqgdpevieflneqltaeltainqyflhaklqdhkgwtklakytraesfdemrhaevltd
    rillldglpnyqrlfhvrvgqsvtemfqadreveleaidrlrrgievmrakhditsanvf
    eailadeehhidyletqldlieklgeslylstvieqtqpdps
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5xx9D (D:)
    mqgdpevieflneqltaeltainqyflhaklqdhkgwtklakytraesfdemrhaevltd
    rillldglpnyqrlfhvrvgqsvtemfqadreveleaidrlrrgievmrakhditsanvf
    eailadeehhidyletqldlieklgeslylstvieqtqpdpsgpgsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xx9D (D:)
    mqgdpevieflneqltaeltainqyflhaklqdhkgwtklakytraesfdemrhaevltd
    rillldglpnyqrlfhvrvgqsvtemfqadreveleaidrlrrgievmrakhditsanvf
    eailadeehhidyletqldlieklgeslylstvieqt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5xx9E (E:)
    mqgdpevieflneqltaeltainqyflhaklqdhkgwtklakytraesfdemrhaevltd
    rillldglpnyqrlfhvrvgqsvtemfqadreveleaidrlrrgievmrakhditsanvf
    eailadeehhidyletqldlieklgeslylstvieqtqpdpsgpgsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xx9E (E:)
    mqgdpevieflneqltaeltainqyflhaklqdhkgwtklakytraesfdemrhaevltd
    rillldglpnyqrlfhvrvgqsvtemfqadreveleaidrlrrgievmrakhditsanvf
    eailadeehhidyletqldlieklgeslylstvieqtqpdp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5xx9F (F:)
    mqgdpevieflneqltaeltainqyflhaklqdhkgwtklakytraesfdemrhaevltd
    rillldglpnyqrlfhvrvgqsvtemfqadreveleaidrlrrgievmrakhditsanvf
    eailadeehhidyletqldlieklgeslylstvieqtqpdpsgpgsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xx9F (F:)
    mqgdpevieflneqltaeltainqyflhaklqdhkgwtklakytraesfdemrhaevltd
    rillldglpnyqrlfhvrvgqsvtemfqadreveleaidrlrrgievmrakhditsanvf
    eailadeehhidyletqldlieklgeslylstvieqtqpdp