PDB entry 5xwe

View 5xwe on RCSB PDB site
Description: Structure of a three finger toxin from Ophiophagus hannah venom
Class: toxin
Keywords: Three finger toxin, Snake venom, TOXIN
Deposited on 2017-06-29, released 2018-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Weak toxin DE-1 homolog 1
    Species: OPHIOPHAGUS HANNAH [TaxId:8665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xwea_
  • Chain 'B':
    Compound: Weak toxin DE-1 homolog 1
    Species: OPHIOPHAGUS HANNAH [TaxId:8665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xweb_
  • Heterogens: CL, GLY, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xweA (A:)
    mkpvlltlvvvtivcldlgytriclkqepfqpettttcpegedacynlfwsdhseikiem
    gcgcpktepytnlycckidscnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xweA (A:)
    riclkqettttcpegedacynlfwkiemgcgcpktepytnlycckidscnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xweB (B:)
    mkpvlltlvvvtivcldlgytriclkqepfqpettttcpegedacynlfwsdhseikiem
    gcgcpktepytnlycckidscnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xweB (B:)
    riclkqettttcpegedacynlfwkiemgcgcpktepytnlycckidscnk