PDB entry 5xwc

View 5xwc on RCSB PDB site
Description: Crystal Structure of Aspergillus niger Glutamate Dehydrogenase Complexed With Alpha-iminoglutarate, 2-amino-2-hydroxyglutarate and NADP
Class: oxidoreductase
Keywords: Glutamate Dehydrogenase, Aspergillus niger, Alpha-iminoglutarate, 2-amino-2-hydroxyglutarate, NADP, Coenzyme, Reaction Intermediate, OXIDOREDUCTASE
Deposited on 2017-06-29, released 2018-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamate dehydrogenase
    Species: Aspergillus niger [TaxId:5061]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xwca1
  • Heterogens: NAP, 8GL, 2IT, GOL, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xwcA (A:)
    msnlphepefeqaykelastlenstlfqknpeyrkalavvsvperviqfrvvweddagnv
    qvnrgfrvqfnsalgpykgglrfhpsvnlsilkflgfeqifknaltglnmgggkggsdfd
    pkgksdneirrfcvsfmtelckhigadtdvpagdigvtgrevgflfgqyrkirnqwegvl
    tgkggswggslirpeatgygvvyyvehmiahatngqesfkgkrvaisgsgnvaqyaalkv
    ielggsvvslsdsqgsliingegsftpeeieliaqtkverkqlasivgaapfsdankfky
    iagarpwvhvgkvdvalpsatqneisgeeaqvlinagckfiaegsnmgctqeaidtfeah
    rtanagaaaiwyapgkaanaggvavsglemaqnsarlswtseevdarlkdimrdcfkngl
    etaqeyatpaegvlpslvtgsniagftkvaaamkdqgdww
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xwcA (A:)
    snlphepefeqaykelastlenstlfqknpeyrkalavvsvperviqfrvvweddagnvq
    vnrgfrvqfnsalgpykgglrfhpsvnlsilkflgfeqifknaltglnmgggkggsdfdp
    kgksdneirrfcvsfmtelckhigadtdvpagdigvtgrevgflfgqyrkirnqwegvlt
    gkggswggslirpeatgygvvyyvehmiahatngqesfkgkrvaisgsgnvaqyaalkvi
    elggsvvslsdsqgsliingegsftpeeieliaqtkverkqlasivgaapfsdankfkyi
    agarpwvhvgkvdvalpsatqneisgeeaqvlinagckfiaegsnmgctqeaidtfeahr
    tanagaaaiwyapgkaanaggvavsglemaqnsarlswtseevdarlkdimrdcfkngle
    taqeyatpaegvlpslvtgsniagftkvaaamkdqgdww