PDB entry 5xw2

View 5xw2 on RCSB PDB site
Description: Crystal structure of the Hydroxylase HmtN in C 1 2 1 crystal form
Class: biosynthetic protein
Keywords: himastatin, hydroxylase, cytochrome P450, BIOSYNTHETIC PROTEIN
Deposited on 2017-06-29, released 2018-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-25, with a file datestamp of 2018-04-20.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 107B1 (P450CVIIB1)
    Species: Streptomyces himastatinicus ATCC 53653 [TaxId:457427]
    Gene: hmtN, SSOG_07636
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xw2a_
  • Heterogens: HEM, GOL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xw2A (A:)
    mgsshhhhhhssglvprgshmttpaerwgihpehfwlygrrprqmvefdekmnawnvygy
    aeaievlgdpgtfsshmsrllpmgadeaftegdllqtdppdhrelrklvshaftpkvvae
    lepritaltqelldavadrdtfdlmtalayplpvtvvaellsipsadrhlfegwmteivh
    slgdvsmedapedqerifeagmapmrkmleylrehaaecrrrprgdlmgklieaevdgrr
    ltdnhivnfakmlliagyltttmligntvlcldsypeqaarvradrslipglleesmrfl
    spvaatyrattrdvevagqrlsadqmvmvwfgaanrdarqfaepelfdmtrgpnphlgfg
    rgihfclggplarmegrvaldhlldrfpelytdperpptfmpgfdttgvsslplrtslg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xw2A (A:)
    mttpaerwgihpehfwlygrrprqmvefdekmnawnvygyaeaievlgdpgtfsshmsrl
    lpmgaaftegdllqtdppdhrelrklvshaftpkvvaelepritaltqelldavadrdtf
    dlmtalayplpvtvvaellsipsadrhlfegwmteivhslgapmrkmleylrehaaecrr
    rprgdlmgklieaerrltdnhivnfakmlliagyltttmligntvlcldsypeqaarvra
    drslipglleesmrflspvaatyrattrdvevagqrlsadqmvmvwfgaanrdarqfaep
    elfdmtrgpnphlgfgrgihfclggplarmegrvaldhlldrfpelytdperpptfmpgf
    dttgvsslplrtslg