PDB entry 5xvv

View 5xvv on RCSB PDB site
Description: Crystal Structure of Forward Inhibited Aspergillus niger Glutamate Dehydrogenase With Both Apo- and Alpha Ketoglutarate Bound Subunits
Class: oxidoreductase
Keywords: Aspergillus, Glutamate, Dehydrogenase, 2-Oxoglutarate, Allostery, Forward Inhibition, 2-Mercaptoethanol, OXIDOREDUCTASE
Deposited on 2017-06-28, released 2018-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamate dehydrogenase
    Species: Aspergillus niger [TaxId:5061]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xvva1
  • Chain 'B':
    Compound: glutamate dehydrogenase
    Species: Aspergillus niger [TaxId:5061]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xvvb1
  • Chain 'C':
    Compound: glutamate dehydrogenase
    Species: Aspergillus niger [TaxId:5061]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xvvc1
  • Chain 'D':
    Compound: glutamate dehydrogenase
    Species: Aspergillus niger [TaxId:5061]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xvvd1
  • Chain 'E':
    Compound: glutamate dehydrogenase
    Species: Aspergillus niger [TaxId:5061]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xvve1
  • Chain 'F':
    Compound: glutamate dehydrogenase
    Species: Aspergillus niger [TaxId:5061]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xvvf1
  • Heterogens: GOL, AKG, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xvvA (A:)
    msnlphepefeqaykelastlenstlfqknpeyrkalavvsvperviqfrvvweddagnv
    qvnrgfrvqfnsalgpykgglrfhpsvnlsilkflgfeqifknaltglnmgggkggsdfd
    pkgksdneirrfcvsfmtelckhigadtdvpagdigvtgrevgflfgqyrkirnqwegvl
    tgkggswggslirpeatgygvvyyvehmiahatngqesfkgkrvaisgsgnvaqyaalkv
    ielggsvvslsdsqgsliingegsftpeeieliaqtkverkqlasivgaapfsdankfky
    iagarpwvhvgkvdvalpsatqneisgeeaqvlinagckfiaegsnmgctqeaidtfeah
    rtanagaaaiwyapgkaanaggvavsglemaqnsarlswtseevdarlkdimrdcfkngl
    etaqeyatpaegvlpslvtgsniagftkvaaamkdqgdww
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xvvA (A:)
    nlphepefeqaykelastlenstlfqknpeyrkalavvsvperviqfrvvweddagnvqv
    nrgfrvqfnsalgpykgglrfhpsvnlsilkflgfeqifknaltglnmgggkggsdfdpk
    gksdneirrfcvsfmtelckhigadtdvpagdigvtgrevgflfgqyrkirnqwegvltg
    kggswggslirpeatgygvvyyvehmiahatngqesfkgkrvaisgsgnvaqyaalkvie
    lggsvvslsdsqgsliingegsftpeeieliaqtkverkqlasivgaapfsdankfkyia
    garpwvhvgkvdvalpsatqneisgeeaqvlinagckfiaegsnmgctqeaidtfeahrt
    anagaaaiwyapgkaanaggvavsglemaqnsarlswtseevdarlkdimrdcfknglet
    aqeyatpaegvlpslvtgsniagftkvaaamkdqgdww
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xvvB (B:)
    msnlphepefeqaykelastlenstlfqknpeyrkalavvsvperviqfrvvweddagnv
    qvnrgfrvqfnsalgpykgglrfhpsvnlsilkflgfeqifknaltglnmgggkggsdfd
    pkgksdneirrfcvsfmtelckhigadtdvpagdigvtgrevgflfgqyrkirnqwegvl
    tgkggswggslirpeatgygvvyyvehmiahatngqesfkgkrvaisgsgnvaqyaalkv
    ielggsvvslsdsqgsliingegsftpeeieliaqtkverkqlasivgaapfsdankfky
    iagarpwvhvgkvdvalpsatqneisgeeaqvlinagckfiaegsnmgctqeaidtfeah
    rtanagaaaiwyapgkaanaggvavsglemaqnsarlswtseevdarlkdimrdcfkngl
    etaqeyatpaegvlpslvtgsniagftkvaaamkdqgdww
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xvvB (B:)
    snlphepefeqaykelastlenstlfqknpeyrkalavvsvperviqfrvvweddagnvq
    vnrgfrvqfnsalgpykgglrfhpsvnlsilkflgfeqifknaltglnmgggkggsdfdp
    kgksdneirrfcvsfmtelckhigadtdvpagdigvtgrevgflfgqyrkirnqwegvlt
    gkggswggslirpeatgygvvyyvehmiahatngqesfkgkrvaisgsgnvaqyaalkvi
    elggsvvslsdsqgsliingegsftpeeieliaqtkverkqlasivgaapfsdankfkyi
    agarpwvhvgkvdvalpsatqneisgeeaqvlinagckfiaegsnmgctqeaidtfeahr
    tanagaaaiwyapgkaanaggvavsglemaqnsarlswtseevdarlkdimrdcfkngle
    taqeyatpaegvlpslvtgsniagftkvaaamkdqgdww
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5xvvC (C:)
    msnlphepefeqaykelastlenstlfqknpeyrkalavvsvperviqfrvvweddagnv
    qvnrgfrvqfnsalgpykgglrfhpsvnlsilkflgfeqifknaltglnmgggkggsdfd
    pkgksdneirrfcvsfmtelckhigadtdvpagdigvtgrevgflfgqyrkirnqwegvl
    tgkggswggslirpeatgygvvyyvehmiahatngqesfkgkrvaisgsgnvaqyaalkv
    ielggsvvslsdsqgsliingegsftpeeieliaqtkverkqlasivgaapfsdankfky
    iagarpwvhvgkvdvalpsatqneisgeeaqvlinagckfiaegsnmgctqeaidtfeah
    rtanagaaaiwyapgkaanaggvavsglemaqnsarlswtseevdarlkdimrdcfkngl
    etaqeyatpaegvlpslvtgsniagftkvaaamkdqgdww
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xvvC (C:)
    snlphepefeqaykelastlenstlfqknpeyrkalavvsvperviqfrvvweddagnvq
    vnrgfrvqfnsalgpykgglrfhpsvnlsilkflgfeqifknaltglnmgggkggsdfdp
    kgksdneirrfcvsfmtelckhigadtdvpagdigvtgrevgflfgqyrkirnqwegvlt
    gkggswggslirpeatgygvvyyvehmiahatngqesfkgkrvaisgsgnvaqyaalkvi
    elggsvvslsdsqgsliingegsftpeeieliaqtkverkqlasivgaapfsdankfkyi
    agarpwvhvgkvdvalpsatqneisgeeaqvlinagckfiaegsnmgctqeaidtfeahr
    tanagaaaiwyapgkaanaggvavsglemaqnsarlswtseevdarlkdimrdcfkngle
    taqeyatpaegvlpslvtgsniagftkvaaamkdqgdww
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5xvvD (D:)
    msnlphepefeqaykelastlenstlfqknpeyrkalavvsvperviqfrvvweddagnv
    qvnrgfrvqfnsalgpykgglrfhpsvnlsilkflgfeqifknaltglnmgggkggsdfd
    pkgksdneirrfcvsfmtelckhigadtdvpagdigvtgrevgflfgqyrkirnqwegvl
    tgkggswggslirpeatgygvvyyvehmiahatngqesfkgkrvaisgsgnvaqyaalkv
    ielggsvvslsdsqgsliingegsftpeeieliaqtkverkqlasivgaapfsdankfky
    iagarpwvhvgkvdvalpsatqneisgeeaqvlinagckfiaegsnmgctqeaidtfeah
    rtanagaaaiwyapgkaanaggvavsglemaqnsarlswtseevdarlkdimrdcfkngl
    etaqeyatpaegvlpslvtgsniagftkvaaamkdqgdww
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xvvD (D:)
    nlphepefeqaykelastlenstlfqknpeyrkalavvsvperviqfrvvweddagnvqv
    nrgfrvqfnsalgpykgglrfhpsvnlsilkflgfeqifknaltglnmgggkggsdfdpk
    gksdneirrfcvsfmtelckhigadtdvpagdigvtgrevgflfgqyrkirnqwegvltg
    kggswggslirpeatgygvvyyvehmiahatngqesfkgkrvaisgsgnvaqyaalkvie
    lggsvvslsdsqgsliingegsftpeeieliaqtkverkqlasivgaapfsdankfkyia
    garpwvhvgkvdvalpsatqneisgeeaqvlinagckfiaegsnmgctqeaidtfeahrt
    anagaaaiwyapgkaanaggvavsglemaqnsarlswtseevdarlkdimrdcfknglet
    aqeyatpaegvlpslvtgsniagftkvaaamkdqgdww
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5xvvE (E:)
    msnlphepefeqaykelastlenstlfqknpeyrkalavvsvperviqfrvvweddagnv
    qvnrgfrvqfnsalgpykgglrfhpsvnlsilkflgfeqifknaltglnmgggkggsdfd
    pkgksdneirrfcvsfmtelckhigadtdvpagdigvtgrevgflfgqyrkirnqwegvl
    tgkggswggslirpeatgygvvyyvehmiahatngqesfkgkrvaisgsgnvaqyaalkv
    ielggsvvslsdsqgsliingegsftpeeieliaqtkverkqlasivgaapfsdankfky
    iagarpwvhvgkvdvalpsatqneisgeeaqvlinagckfiaegsnmgctqeaidtfeah
    rtanagaaaiwyapgkaanaggvavsglemaqnsarlswtseevdarlkdimrdcfkngl
    etaqeyatpaegvlpslvtgsniagftkvaaamkdqgdww
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xvvE (E:)
    nlphepefeqaykelastlenstlfqknpeyrkalavvsvperviqfrvvweddagnvqv
    nrgfrvqfnsalgpykgglrfhpsvnlsilkflgfeqifknaltglnmgggkggsdfdpk
    gksdneirrfcvsfmtelckhigadtdvpagdigvtgrevgflfgqyrkirnqwegvltg
    kggswggslirpeatgygvvyyvehmiahatngqesfkgkrvaisgsgnvaqyaalkvie
    lggsvvslsdsqgsliingegsftpeeieliaqtkverkqlasivgaapfsdankfkyia
    garpwvhvgkvdvalpsatqneisgeeaqvlinagckfiaegsnmgctqeaidtfeahrt
    anagaaaiwyapgkaanaggvavsglemaqnsarlswtseevdarlkdimrdcfknglet
    aqeyatpaegvlpslvtgsniagftkvaaamkdqgdww
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5xvvF (F:)
    msnlphepefeqaykelastlenstlfqknpeyrkalavvsvperviqfrvvweddagnv
    qvnrgfrvqfnsalgpykgglrfhpsvnlsilkflgfeqifknaltglnmgggkggsdfd
    pkgksdneirrfcvsfmtelckhigadtdvpagdigvtgrevgflfgqyrkirnqwegvl
    tgkggswggslirpeatgygvvyyvehmiahatngqesfkgkrvaisgsgnvaqyaalkv
    ielggsvvslsdsqgsliingegsftpeeieliaqtkverkqlasivgaapfsdankfky
    iagarpwvhvgkvdvalpsatqneisgeeaqvlinagckfiaegsnmgctqeaidtfeah
    rtanagaaaiwyapgkaanaggvavsglemaqnsarlswtseevdarlkdimrdcfkngl
    etaqeyatpaegvlpslvtgsniagftkvaaamkdqgdww
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xvvF (F:)
    lphepefeqaykelastlenstlfqknpeyrkalavvsvperviqfrvvweddagnvqvn
    rgfrvqfnsalgpykgglrfhpsvnlsilkflgfeqifknaltglnmgggkggsdfdpkg
    ksdneirrfcvsfmtelckhigadtdvpagdigvtgrevgflfgqyrkirnqwegvltgk
    ggswggslirpeatgygvvyyvehmiahatngqesfkgkrvaisgsgnvaqyaalkviel
    ggsvvslsdsqgsliingegsftpeeieliaqtkverkqlasivgaapfsdankfkyiag
    arpwvhvgkvdvalpsatqneisgeeaqvlinagckfiaegsnmgctqeaidtfeahrta
    nagaaaiwyapgkaanaggvavsglemaqnsarlswtseevdarlkdimrdcfkngleta
    qeyatpaegvlpslvtgsniagftkvaaamkdqgdww