PDB entry 5xvs

View 5xvs on RCSB PDB site
Description: Crystal structure of UDP-GlcNAc 2-epimerase NeuC complexed with UDP
Class: hydrolase
Keywords: NeuC, UDP N-acetylglucosamine 2-epimerase, TRANSFERASE, HYDROLASE
Deposited on 2017-06-28, released 2018-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GDP/UDP-N,N'-diacetylbacillosamine 2-epimerase (Hydrolyzing)
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: legG, LV38_02406
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xvsa1, d5xvsa2
  • Chain 'B':
    Compound: GDP/UDP-N,N'-diacetylbacillosamine 2-epimerase (Hydrolyzing)
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: legG, LV38_02406
    Database cross-references and differences (RAF-indexed):
  • Heterogens: LI, UDP, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xvsA (A:)
    mkkiavftgtraeygllywlmrdiqqdpelelqilatamhyspehgetwktivkdgfeit
    esvemllssdtssavvksmgvgllgfadalkrmqpdvlvvlgdrfealavtqaalimhvp
    vahlhggeitegaydesirhaitkmsnihfaaaeeykkriiqlgeqpervfnvgalgldh
    iqrttfksiselselydfdfskpyflityhpetnlleenvaplfdalkqindvnfifsyp
    nadngntnivkamldlkaqlpdrvllvksfgiqnylsvlknalamvgnsssglseapalq
    vptvnigdrqkgrlrcesildvrldeneivealqkainfpkdqlsqvvpplglgntsqki
    ievikttdfkkkapfydll
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xvsA (A:)
    mkkiavftgtraeygllywlmrdiqqdpelelqilatamhyspehgetwktivkdgfeit
    esvemllssdtssavvksmgvgllgfadalkrmqpdvlvvlgdrfealavtqaalimhvp
    vahlhggeitegaydesirhaitkmsnihfaaaeeykkriiqlgeqpervfnvgalgldh
    iqrttfksiselselydfdfskpyflityhpenvaplfdalkqindvnfifsypntnivk
    amldlkaqlpdrvllvksfgiqnylsvlknalamvgnsssglseapalqvptvnigdrqk
    grlrcesildvrldeneivealqkainfpplglgntsqkiievikttdfkkkapfydll
    

  • Chain 'B':
    No sequence available.