PDB entry 5xvb

View 5xvb on RCSB PDB site
Description: [NiFe]-hydrogenase 2 from Citrobacter sp. S-77 in an H2-reduced condition
Class: oxidoreductase
Keywords: [NiFe]-hydrogenase, OXIDOREDUCTASE
Deposited on 2017-06-27, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'L':
    Compound: [NiFe]-hydrogenase 2 large subunit
    Species: Citrobacter sp. S-77 [TaxId:1080067]
    Database cross-references and differences (RAF-indexed):
    • PDB 5XVB
    Domains in SCOPe 2.07: d5xvbl_
  • Chain 'M':
    Compound: [NiFe]-hydrogenase 2 large subunit
    Species: Citrobacter sp. S-77 [TaxId:1080067]
    Database cross-references and differences (RAF-indexed):
    • PDB 5XVB
    Domains in SCOPe 2.07: d5xvbm_
  • Chain 'S':
    Compound: [NiFe]-hydrogenase 2 small subunit
    Species: Citrobacter sp. S-77 [TaxId:1080067]
    Database cross-references and differences (RAF-indexed):
    • PDB 5XVB
    Domains in SCOPe 2.07: d5xvbs_
  • Chain 'T':
    Compound: [NiFe]-hydrogenase 2 small subunit
    Species: Citrobacter sp. S-77 [TaxId:1080067]
    Database cross-references and differences (RAF-indexed):
    • PDB 5XVB
    Domains in SCOPe 2.07: d5xvbt_
  • Heterogens: MG, NFU, GOL, SF4, F3S, HOH

PDB Chain Sequences:

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5xvbL (L:)
    msqritidpvtrieghlridceiengvvskawasgtmwrgmeeivknrdprdawmivqri
    cgvcttthaissvraaesalnidvpvnaqyirniilaahtthdhivhfyqlsaldwvdit
    salkadpakasamlngvstwhlnsaeeftkvqnkikdlvasgqlgifangcwghpamqlp
    pevnliavahylqalecqrdanrvvallggktphiqnlavggvanpinldglgvlnlerl
    myiksfidklsdfveqvykvdtaviaafypewlergqgavnylsapefptdgkngsflfp
    ggyitdadlstyrpitshsdeylikgiqesakhawykdeapqapwegttvpdytgwsddg
    kyswvkaptfygktvevgplanmlcklaakresthaklneivaiytkltgktievaqlhs
    tlgriigrtvhccelqnvlqdqynalivnigkgdhttfvkpdipatgefkgvgfleaprg
    mlshwmvikdgiisnyqavvpstwnsgprnfndevgpyerslvgtpiadpnkplevvrti
    hsfdpcmscavhvvdvdgnevvsvkvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xvbL (L:)
    sqritidpvtrieghlridceiengvvskawasgtmwrgmeeivknrdprdawmivqric
    gvcttthaissvraaesalnidvpvnaqyirniilaahtthdhivhfyqlsaldwvdits
    alkadpakasamlngvstwhlnsaeeftkvqnkikdlvasgqlgifangcwghpamqlpp
    evnliavahylqalecqrdanrvvallggktphiqnlavggvanpinldglgvlnlerlm
    yiksfidklsdfveqvykvdtaviaafypewlergqgavnylsapefptdgkngsflfpg
    gyitdadlstyrpitshsdeylikgiqesakhawykdeapqapwegttvpdytgwsddgk
    yswvkaptfygktvevgplanmlcklaakresthaklneivaiytkltgktievaqlhst
    lgriigrtvhccelqnvlqdqynalivnigkgdhttfvkpdipatgefkgvgfleaprgm
    lshwmvikdgiisnyqavvpstwnsgprnfndevgpyerslvgtpiadpnkplevvrtih
    sfdpcmscavh
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5xvbM (M:)
    msqritidpvtrieghlridceiengvvskawasgtmwrgmeeivknrdprdawmivqri
    cgvcttthaissvraaesalnidvpvnaqyirniilaahtthdhivhfyqlsaldwvdit
    salkadpakasamlngvstwhlnsaeeftkvqnkikdlvasgqlgifangcwghpamqlp
    pevnliavahylqalecqrdanrvvallggktphiqnlavggvanpinldglgvlnlerl
    myiksfidklsdfveqvykvdtaviaafypewlergqgavnylsapefptdgkngsflfp
    ggyitdadlstyrpitshsdeylikgiqesakhawykdeapqapwegttvpdytgwsddg
    kyswvkaptfygktvevgplanmlcklaakresthaklneivaiytkltgktievaqlhs
    tlgriigrtvhccelqnvlqdqynalivnigkgdhttfvkpdipatgefkgvgfleaprg
    mlshwmvikdgiisnyqavvpstwnsgprnfndevgpyerslvgtpiadpnkplevvrti
    hsfdpcmscavhvvdvdgnevvsvkvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xvbM (M:)
    sqritidpvtrieghlridceiengvvskawasgtmwrgmeeivknrdprdawmivqric
    gvcttthaissvraaesalnidvpvnaqyirniilaahtthdhivhfyqlsaldwvdits
    alkadpakasamlngvstwhlnsaeeftkvqnkikdlvasgqlgifangcwghpamqlpp
    evnliavahylqalecqrdanrvvallggktphiqnlavggvanpinldglgvlnlerlm
    yiksfidklsdfveqvykvdtaviaafypewlergqgavnylsapefptdgkngsflfpg
    gyitdadlstyrpitshsdeylikgiqesakhawykdeapqapwegttvpdytgwsddgk
    yswvkaptfygktvevgplanmlcklaakresthaklneivaiytkltgktievaqlhst
    lgriigrtvhccelqnvlqdqynalivnigkgdhttfvkpdipatgefkgvgfleaprgm
    lshwmvikdgiisnyqavvpstwnsgprnfndevgpyerslvgtpiadpnkplevvrtih
    sfdpcmscavh
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >5xvbS (S:)
    emaesvsrpqrppviwigaqectgctesllrathptvenlvletisleyhevlsaafghq
    veenkhnalekykgqyvlvvdgsiplkdngiycmvagepivdhirraaegaaaiiaigsc
    aawggvaaagvnptgavglqevlpgktiinipgcppnphnflatvahiitygkppkldak
    nrptfaygrlihehcerrphfdagrfakefgdeghregwclyhlgckgpetygncstlqf
    cdvggvwpvaighpcygcneegigfhkgihqlahvenqtprsekpdvnikeggnisagav
    gllggvvglvagvsvmavrelgrqqkkdnadsrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xvbS (S:)
    pqrppviwigaqectgctesllrathptvenlvletisleyhevlsaafghqveenkhna
    lekykgqyvlvvdgsiplkdngiycmvagepivdhirraaegaaaiiaigscaawggvaa
    agvnptgavglqevlpgktiinipgcppnphnflatvahiitygkppkldaknrptfayg
    rlihehcerrphfdagrfakefgdeghregwclyhlgckgpetygncstlqfcdvggvwp
    vaighpcygcneegigfhkgihqlahve
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >5xvbT (T:)
    emaesvsrpqrppviwigaqectgctesllrathptvenlvletisleyhevlsaafghq
    veenkhnalekykgqyvlvvdgsiplkdngiycmvagepivdhirraaegaaaiiaigsc
    aawggvaaagvnptgavglqevlpgktiinipgcppnphnflatvahiitygkppkldak
    nrptfaygrlihehcerrphfdagrfakefgdeghregwclyhlgckgpetygncstlqf
    cdvggvwpvaighpcygcneegigfhkgihqlahvenqtprsekpdvnikeggnisagav
    gllggvvglvagvsvmavrelgrqqkkdnadsrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xvbT (T:)
    pqrppviwigaqectgctesllrathptvenlvletisleyhevlsaafghqveenkhna
    lekykgqyvlvvdgsiplkdngiycmvagepivdhirraaegaaaiiaigscaawggvaa
    agvnptgavglqevlpgktiinipgcppnphnflatvahiitygkppkldaknrptfayg
    rlihehcerrphfdagrfakefgdeghregwclyhlgckgpetygncstlqfcdvggvwp
    vaighpcygcneegigfhkgihqlahve