PDB entry 5xv9

View 5xv9 on RCSB PDB site
Description: Solution Structure of Cold Shock Protein from Colwellia psychrerythraea
Class: RNA binding protein
Keywords: Cold-shock protein, Psychrophile, NMR spectroscopy, solution structure, RNA BINDING PROTEIN
Deposited on 2017-06-27, released 2018-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-04, with a file datestamp of 2018-06-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cold-shock DNA-binding domain family protein
    Species: Colwellia psychrerythraea (strain 34H / ATCC BAA-681) [TaxId:167879]
    Gene: CPS_0718
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xv9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xv9A (A:)
    mskgivkwfnsdkgfgfitpedgskdlfvhhseiqsggeyatladgqtveyevgqgqkgp
    cankvvav