PDB entry 5xv8

View 5xv8 on RCSB PDB site
Description: Solution structure of the complex between UVSSA acidic region and TFIIH p62 PH domain
Class: nuclear protein
Keywords: DNA repair factor, general transcription factor, nucleotide excision repair, transcription-coupled repair, NUCLEAR PROTEIN
Deposited on 2017-06-27, released 2017-11-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-12-27, with a file datestamp of 2017-12-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UV-stimulated scaffold protein A
    Species: Homo sapiens [TaxId:9606]
    Gene: UVSSA, KIAA1530
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: General transcription factor IIH subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: GTF2H1, BTF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32780 (3-109)
      • expression tag (2)
    Domains in SCOPe 2.08: d5xv8b1, d5xv8b2

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xv8B (B:)
    gsmatsseevllivkkvrqkkqdgalylmaeriawapegkdrftishmyadikcqkispe
    gkakiqlqlvlhagdttnfhfsnestavkerdavkdllqqllpkfkrkan
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xv8B (B:)
    matsseevllivkkvrqkkqdgalylmaeriawapegkdrftishmyadikcqkispegk
    akiqlqlvlhagdttnfhfsnestavkerdavkdllqqllpkfkrkan