PDB entry 5xv8
View 5xv8 on RCSB PDB site
Description: Solution structure of the complex between UVSSA acidic region and TFIIH p62 PH domain
Class: nuclear protein
Keywords: DNA repair factor, general transcription factor, nucleotide excision repair, transcription-coupled repair, NUCLEAR PROTEIN
Deposited on
2017-06-27, released
2017-11-08
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-12-27, with a file datestamp of
2017-12-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: UV-stimulated scaffold protein A
Species: Homo sapiens [TaxId:9606]
Gene: UVSSA, KIAA1530
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: General transcription factor IIH subunit 1
Species: Homo sapiens [TaxId:9606]
Gene: GTF2H1, BTF2
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d5xv8b1, d5xv8b2
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence, based on SEQRES records: (download)
>5xv8B (B:)
gsmatsseevllivkkvrqkkqdgalylmaeriawapegkdrftishmyadikcqkispe
gkakiqlqlvlhagdttnfhfsnestavkerdavkdllqqllpkfkrkan
Sequence, based on observed residues (ATOM records): (download)
>5xv8B (B:)
matsseevllivkkvrqkkqdgalylmaeriawapegkdrftishmyadikcqkispegk
akiqlqlvlhagdttnfhfsnestavkerdavkdllqqllpkfkrkan