PDB entry 5xv0

View 5xv0 on RCSB PDB site
Description: Crystal structure of Rib7 mutant D33N from Methanosarcina mazei
Class: oxidoreductase
Keywords: Rib7, riboflavin biosynthesis, OXIDOREDUCTASE
Deposited on 2017-06-26, released 2018-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-04, with a file datestamp of 2018-06-29.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved protein
    Species: Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) [TaxId:192952]
    Gene: MM_0826
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8PYN5 (12-239)
      • expression tag (2-11)
      • engineered mutation (44)
    Domains in SCOPe 2.07: d5xv0a1, d5xv0a2
  • Chain 'B':
    Compound: conserved protein
    Species: Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) [TaxId:192952]
    Gene: MM_0826
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8PYN5 (12-End)
      • engineered mutation (44)
    Domains in SCOPe 2.07: d5xv0b_
  • Chain 'C':
    Compound: conserved protein
    Species: Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) [TaxId:192952]
    Gene: MM_0826
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8PYN5 (12-End)
      • engineered mutation (44)
    Domains in SCOPe 2.07: d5xv0c_
  • Chain 'D':
    Compound: conserved protein
    Species: Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) [TaxId:192952]
    Gene: MM_0826
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8PYN5
      • engineered mutation (44)
    Domains in SCOPe 2.07: d5xv0d_
  • Chain 'E':
    Compound: conserved protein
    Species: Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) [TaxId:192952]
    Gene: MM_0826
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8PYN5
      • engineered mutation (44)
    Domains in SCOPe 2.07: d5xv0e_
  • Chain 'F':
    Compound: conserved protein
    Species: Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) [TaxId:192952]
    Gene: MM_0826
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8PYN5 (12-239)
      • expression tag (1-11)
      • engineered mutation (44)
    Domains in SCOPe 2.07: d5xv0f1, d5xv0f2
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xv0A (A:)
    mrgshhhhhhgsmdrpfifinsamsadgklstkerkqvkisgklnfermdelrahadaim
    vgigtvladdpsltvksperkaarkaagksenpvrvvvdssartplnadifkkgeglrii
    avsnsapeekirmleekalviktgafrvdltelaaklkemginslmveggatlnwgmlsa
    glvdevytfvgnliiggktaptftdgegftenellglelssaekiedgillkwkvkgkkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xv0A (A:)
    gshhhhhhgsmdrpfifinsamsadgklstkerkqvkisgklnfermdelrahadaimvg
    igtvladdpsltvksperkaarkaagksenpvrvvvdssartplnadifkkgeglriiav
    snsapeekirmleekalviktgafrvdltelaaklkemginslmveggatlnwgmlsagl
    vdevytfvgnliiggktaptftdgegftenellglelssaekiedgillkwkvkgkkn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xv0B (B:)
    mrgshhhhhhgsmdrpfifinsamsadgklstkerkqvkisgklnfermdelrahadaim
    vgigtvladdpsltvksperkaarkaagksenpvrvvvdssartplnadifkkgeglrii
    avsnsapeekirmleekalviktgafrvdltelaaklkemginslmveggatlnwgmlsa
    glvdevytfvgnliiggktaptftdgegftenellglelssaekiedgillkwkvkgkkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xv0B (B:)
    mdrpfifinsamsadgklstkerkqvkisgklnfermdelrahadaimvgigtvladdps
    ltvksperkaarkaagksenpvrvvvdssartplnadifkkgeglriiavsnsapeekir
    mleekalviktgafrvdltelaaklkemginslmveggatlnwgmlsaglvdevytfvgn
    liiggktaptftdgegftenellglelssaekiedgillkwkvk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5xv0C (C:)
    mrgshhhhhhgsmdrpfifinsamsadgklstkerkqvkisgklnfermdelrahadaim
    vgigtvladdpsltvksperkaarkaagksenpvrvvvdssartplnadifkkgeglrii
    avsnsapeekirmleekalviktgafrvdltelaaklkemginslmveggatlnwgmlsa
    glvdevytfvgnliiggktaptftdgegftenellglelssaekiedgillkwkvkgkkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xv0C (C:)
    mdrpfifinsamsadgklstkerkqvkisgklnfermdelrahadaimvgigtvladdps
    ltvksperkaarkaagksenpvrvvvdssartplnadifkkgeglriiavsnsapeekir
    mleekalviktgafrvdltelaaklkemginslmveggatlnwgmlsaglvdevytfvgn
    liiggktaptftdgegftenellglelssaekiedgillkwkvk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5xv0D (D:)
    mrgshhhhhhgsmdrpfifinsamsadgklstkerkqvkisgklnfermdelrahadaim
    vgigtvladdpsltvksperkaarkaagksenpvrvvvdssartplnadifkkgeglrii
    avsnsapeekirmleekalviktgafrvdltelaaklkemginslmveggatlnwgmlsa
    glvdevytfvgnliiggktaptftdgegftenellglelssaekiedgillkwkvkgkkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xv0D (D:)
    drpfifinsamsadgklstkerkqvkisgklnfermdelrahadaimvgigtvladdpsl
    tvksperkaarkaagksenpvrvvvdssartplnadifkkgeglriiavsnsapeekirm
    leekalviktgafrvdltelaaklkemginslmveggatlnwgmlsaglvdevytfvgnl
    iiggktaptftdgegftenellglelssaekiedgillkwkvk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5xv0E (E:)
    mrgshhhhhhgsmdrpfifinsamsadgklstkerkqvkisgklnfermdelrahadaim
    vgigtvladdpsltvksperkaarkaagksenpvrvvvdssartplnadifkkgeglrii
    avsnsapeekirmleekalviktgafrvdltelaaklkemginslmveggatlnwgmlsa
    glvdevytfvgnliiggktaptftdgegftenellglelssaekiedgillkwkvkgkkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xv0E (E:)
    drpfifinsamsadgklstkerkqvkisgklnfermdelrahadaimvgigtvladdpsl
    tvksperkaarkaagksenpvrvvvdssartplnadifkkgeglriiavsnsapeekirm
    leekalviktgafrvdltelaaklkemginslmveggatlnwgmlsaglvdevytfvgnl
    iiggktaptftdgegftenellglelssaekiedgillkwkvk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5xv0F (F:)
    mrgshhhhhhgsmdrpfifinsamsadgklstkerkqvkisgklnfermdelrahadaim
    vgigtvladdpsltvksperkaarkaagksenpvrvvvdssartplnadifkkgeglrii
    avsnsapeekirmleekalviktgafrvdltelaaklkemginslmveggatlnwgmlsa
    glvdevytfvgnliiggktaptftdgegftenellglelssaekiedgillkwkvkgkkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xv0F (F:)
    rgshhhhhhgsmdrpfifinsamsadgklstkerkqvkisgklnfermdelrahadaimv
    gigtvladdpsltvksperkaarkaagksenpvrvvvdssartplnadifkkgeglriia
    vsnsapeekirmleekalviktgafrvdltelaaklkemginslmveggatlnwgmlsag
    lvdevytfvgnliiggktaptftdgegftenellglelssaekiedgillkwkvkgkkn