PDB entry 5xuw

View 5xuw on RCSB PDB site
Description: Crystal structure of lysozyme from Equus asinus
Class: hydrolase
Keywords: anti-microbial, anti-tumor, ENDOCYTOSIS, HYDROLASE
Deposited on 2017-06-26, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: Equus asinus [TaxId:9793]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xuwa_
  • Chain 'B':
    Compound: Lysozyme C
    Species: Equus asinus [TaxId:9793]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xuwb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xuwA (A:)
    kvfskcelahklkaqemdgfggyslanwvcmaeyesnfntrafngknangsydyglfqln
    skwwckdnkrsssnacnimcskllddnidddiscakrvvrdpkgmsawkawvkhckdkdl
    seylascnl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xuwB (B:)
    kvfskcelahklkaqemdgfggyslanwvcmaeyesnfntrafngknangsydyglfqln
    skwwckdnkrsssnacnimcskllddnidddiscakrvvrdpkgmsawkawvkhckdkdl
    seylascnl