PDB entry 5xup

View 5xup on RCSB PDB site
Description: Crystal structure of TRF1 and TERB1
Class: DNA binding protein
Keywords: telomere, meiosis, DNA BINDING PROTEIN
Deposited on 2017-06-24, released 2017-11-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Telomeric repeat-binding factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TERF1, PIN2, TRBF1, TRF, TRF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xupa_
  • Chain 'B':
    Compound: Telomeric repeat-binding factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TERF1, PIN2, TRBF1, TRF, TRF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xupb_
  • Chain 'C':
    Compound: Telomere repeats-binding bouquet formation protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TERB1, CCDC79
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Telomere repeats-binding bouquet formation protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TERB1, CCDC79
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xupA (A:)
    glvaeaeavaagwmldflclslcrafrdgrsedfrrtrnsaeaiihglssltacqlrtiy
    icqfltriaagktldaqfenderitplesalmiwgsiekehdklheeiqnlikiqaiavc
    mengnfkeaeevferifgdpnshmpfkskllmiisqkdtfhsffqhfsynhmmekiksyv
    nyvlseksstflmkaaakvves
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xupB (B:)
    glvaeaeavaagwmldflclslcrafrdgrsedfrrtrnsaeaiihglssltacqlrtiy
    icqfltriaagktldaqfenderitplesalmiwgsiekehdklheeiqnlikiqaiavc
    mengnfkeaeevferifgdpnshmpfkskllmiisqkdtfhsffqhfsynhmmekiksyv
    nyvlseksstflmkaaakvves
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xupB (B:)
    glvaeaeavaagwmldflclslcrafrdgrsedfrrtrnsaeaiihglssltacqlrtiy
    icqfltriaagktldaqfenderitplesalmiwgsiekehdklheeiqnlikiqaiavc
    mengnfkeaeevferifhmpfkskllmiisqkdtfhsffqhfsynhmmekiksyvnyvls
    eksstflmkaaakvve
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.