PDB entry 5xuk

View 5xuk on RCSB PDB site
Description: Crystal structure of Helicobacter pylori holo-[acyl-carrier-protein] synthase (AcpS) in complex with coenzyme A
Class: transferase
Keywords: Gram-negative bacteria, phosphopantetheinyl transferase, homotrimer, TRANSFERASE
Deposited on 2017-06-23, released 2018-06-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Holo-[acyl-carrier-protein] synthase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: acpS, HP_0808
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5xuka_
  • Heterogens: COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xukA (A:)
    migidivsiariekcvkrfkmkflerflspseivlckdksssiagffalkeacskalqvg
    igkelsfldikiskspknaplitlskekmdyfniqslsasishdagfaiavvvvsssne
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xukA (A:)
    migidivsiariekcvkrfkmkflerflspseivlckdksssiagffalkeacskalqvg
    igkelsfldikiskspknaplitlskekmdyfniqslsasishdagfaiavvvvs