PDB entry 5xuh

View 5xuh on RCSB PDB site
Description: Crystal structure of Escherichia coli holo-[acyl-carrier-protein] synthase (AcpS) D9A mutant in complex with CoA
Class: transferase
Keywords: Gram-negative bacteria, phosphopantetheinyl transferase, homotrimer, TRANSFERASE
Deposited on 2017-06-23, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Holo-[acyl-carrier-protein] synthase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: acpS, dpj, b2563, JW2547
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24224 (Start-125)
      • engineered mutation (8)
    Domains in SCOPe 2.07: d5xuha_
  • Chain 'B':
    Compound: Holo-[acyl-carrier-protein] synthase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: acpS, dpj, b2563, JW2547
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24224 (Start-125)
      • engineered mutation (8)
    Domains in SCOPe 2.07: d5xuhb_
  • Chain 'C':
    Compound: Holo-[acyl-carrier-protein] synthase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: acpS, dpj, b2563, JW2547
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24224 (Start-125)
      • engineered mutation (8)
    Domains in SCOPe 2.07: d5xuhc_
  • Heterogens: CL, GOL, COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xuhA (A:)
    mailglgtaiveiarieaviarsgdrlarrvlsdnewaiwkthhqpvrflakrfavkeaa
    akafgtgirnglafnqfevfndelgkprlrlwgealklaeklgvanmhvtladerhyaca
    tviies
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xuhA (A:)
    ailglgtaiveiarieaviarsgdrlarrvlsdnewaiwkthhqpvrflakrfavkeaaa
    kafgtgirnglafnqfevfndelgkprlrlwgealklaeklgvanmhvtladerhyacat
    viies
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xuhB (B:)
    mailglgtaiveiarieaviarsgdrlarrvlsdnewaiwkthhqpvrflakrfavkeaa
    akafgtgirnglafnqfevfndelgkprlrlwgealklaeklgvanmhvtladerhyaca
    tviies
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xuhB (B:)
    ailglgtaiveiarieaviarsgdrlarrvlsdnewaiwkthhqpvrflakrfavkeaaa
    kafgafnqfevfndelgkprlrlwgealklaeklgvanmhvtladerhyacatviies
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5xuhC (C:)
    mailglgtaiveiarieaviarsgdrlarrvlsdnewaiwkthhqpvrflakrfavkeaa
    akafgtgirnglafnqfevfndelgkprlrlwgealklaeklgvanmhvtladerhyaca
    tviies
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xuhC (C:)
    ailglgtaiveiarieaviarsgdrlarrvlsdnewaiwkthhqpvrflakrfavkeaaa
    kafgtgirnglafnqfevfndelgkprlrlwgealklaeklgvanmhvtladerhyacat
    viies