PDB entry 5xu7

View 5xu7 on RCSB PDB site
Description: Crystal structure of Escherichia coli holo-[acyl-carrier-protein] synthase (AcpS)
Class: transferase
Keywords: Gram-negative bacteria, phosphopantetheinyl transferase, homotrimer, TRANSFERASE
Deposited on 2017-06-22, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Holo-[acyl-carrier-protein] synthase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: acpS, dpj, b2563, JW2547
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xu7a_
  • Chain 'B':
    Compound: Holo-[acyl-carrier-protein] synthase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: acpS, dpj, b2563, JW2547
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xu7b_
  • Chain 'C':
    Compound: Holo-[acyl-carrier-protein] synthase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: acpS, dpj, b2563, JW2547
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xu7c_
  • Heterogens: CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xu7A (A:)
    mailglgtdiveiarieaviarsgdrlarrvlsdnewaiwkthhqpvrflakrfavkeaa
    akafgtgirnglafnqfevfndelgkprlrlwgealklaeklgvanmhvtladerhyaca
    tviies
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xu7A (A:)
    ailglgtdiveiarieaviarsgdrlarrvlsdnewaiwkthhqpvrflakrfavkeaaa
    kafgtlafnqfevfndelgkprlrlwgealklaeklgvanmhvtladerhyacatviies
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xu7B (B:)
    mailglgtdiveiarieaviarsgdrlarrvlsdnewaiwkthhqpvrflakrfavkeaa
    akafgtgirnglafnqfevfndelgkprlrlwgealklaeklgvanmhvtladerhyaca
    tviies
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xu7B (B:)
    ailglgtdiveiarieaviarsgdrlarrvlsdnewaiwkthhqpvrflakrfavkeaaa
    kafglafnqfevfndelgkprlrlwgealklaeklgvanmhvtladerhyacatviies
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5xu7C (C:)
    mailglgtdiveiarieaviarsgdrlarrvlsdnewaiwkthhqpvrflakrfavkeaa
    akafgtgirnglafnqfevfndelgkprlrlwgealklaeklgvanmhvtladerhyaca
    tviies
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xu7C (C:)
    ailglgtdiveiarieaviarsgdrlarrvlsdnewaiwkthhqpvrflakrfavkeaaa
    kafglafnqfevfndelgkprlrlwgealklaeklgvanmhvtladerhyacatviies