PDB entry 5xu2

View 5xu2 on RCSB PDB site
Description: Crystal Structure of Transketolase in complex with TPP_III and fructose-6-phosphate from Pichia Stipitis
Class: transferase
Keywords: transketolase, TRANSFERASE
Deposited on 2017-06-22, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 0.97 Å
R-factor: N/A
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transketolase
    Species: Scheffersomyces stipitis CBS 6054 [TaxId:322104]
    Gene: TKT, TKT1, PICST_67105
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xu2a1, d5xu2a2, d5xu2a3
  • Heterogens: CA, 8EL, F6R, OCS, PEG, TPP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xu2A (A:)
    mgsshhhhhhssglvprgshmssvdqkaistirllavdavaaansghpgaplglapaaha
    vfkkmrfnpkdtkwinrdrfvlsnghacallysmlvlygydltvedlkkfrqlgsktpgh
    pentdvpgaevttgplgqgicngvgialaqaqfaatynkpdfpisdsytyvflgdgclme
    gvsseasslaghlqlgnliafwddnkisidgstevaftedviaryksygwhivevsdadt
    ditaiaaaideakkvtnkptlvrltttigfgslaqgthgvhgaplkaddikqlktkwgfn
    peesfavpaevtasynehvaenqkiqqqwnelfaaykqkypelgaelqrrldgklpenwd
    kalpvytpadaavatrklseivlskiipevpeiiggsadltpsnltkakgtvdfqpaatg
    lgdysgryirygvrehamgaimngiaafganyknyggtflnfvsyaagavrlsalsefpi
    twvathdsiglgedgpthqpietlahfratpnisvwrpadgnetsaayksaiesthtphi
    laltrqnlpqlegssiekaskggytlvqqdkadiiivatgsevslavdalkvlegqgika
    gvvslpdqltfdkqseeyklsvlpdgvpilsvevmstfgwskyshqqfglnrfgasgkap
    eifklfeftpegvaeraaktvafykgkdvvsplrsaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xu2A (A:)
    svdqkaistirllavdavaaansghpgaplglapaahavfkkmrfnpkdtkwinrdrfvl
    snghacallysmlvlygydltvedlkkfrqlgsktpghpentdvpgaevttgplgqgicn
    gvgialaqaqfaatynkpdfpisdsytyvflgdgclmegvsseasslaghlqlgnliafw
    ddnkisidgstevaftedviaryksygwhivevsdadtditaiaaaideakkvtnkptlv
    rltttigfgslaqgthgvhgaplkaddikqlktkwgfnpeesfavpaevtasynehvaen
    qkiqqqwnelfaaykqkypelgaelqrrldgklpenwdkalpvytpadaavatrklseiv
    lskiipevpeiiggsadltpsnltkakgtvdfqpaatglgdysgryirygvrehamgaim
    ngiaafganyknyggtflnfvsyaagavrlsalsefpitwvathdsiglgedgpthqpie
    tlahfratpnisvwrpadgnetsaayksaiesthtphilaltrqnlpqlegssiekaskg
    gytlvqqdkadiiivatgsevslavdalkvlegqgikagvvslpdqltfdkqseeyklsv
    lpdgvpilsvevmstfgwskyshqqfglnrfgasgkapeifklfeftpegvaeraaktva
    fykgkdvvsplrsaf