PDB entry 5xty

View 5xty on RCSB PDB site
Description: Crystal Structure of 11S allergen from Cocos nucifera L.
Class: allergen
Keywords: 11S Allergen, cocosin, coconut, twinning, ALLERGEN
Deposited on 2017-06-21, released 2018-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-06, with a file datestamp of 2018-06-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 11S globulin isoform 1
    Species: Cocos nucifera [TaxId:13894]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xtya1, d5xtya2
  • Chain 'B':
    Compound: 11S globulin isoform 1
    Species: Cocos nucifera [TaxId:13894]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xtyb1, d5xtyb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xtyA (A:)
    masssllsfslcllllchlsqaqfgssqespfqsprrsvssrnecrierlnaleptrtvr
    seagvtdyfdedneqfrcagvstirrvieprglllpsmsnaprlvyivqgrgivglvmpg
    cpetfqsfqrsereegerhrwsrdehqkvyqfqegdvlavpngfaywcynngenpvvait
    vldtsndanqldrshrqfllagrqeqgrqrygregsikenilrgfstellaaafgvnmel
    arklqcrddtrgeivraenglqvlrpsgmeeeereegrsingfeetycsmkikqnigdpr
    radvfnprggrittlnseklpilrfiqmsaervvlyrnamvsphwninahsimyctggrg
    rvevaddrgetvfdgelrqgqllivpqnfamleragsagfqlvsiktsdramvstvvgkt
    salrgmpvevlmnsyrlsrdearrvkltrgdevaiftprresraea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xtyA (A:)
    crierlnaleptrtvrseagvtdyfdedneqfrcagvstirrvieprglllpsmsnaprl
    vyivqgrgivglvmpgcpetfrwsrdehqkvyqfqegdvlavpngfaywcynngenpvva
    itvldtsndanqldrshrqfllagregsikenilrgfstellaaafgvnmerklqcrddt
    rgeivraenglqvlrpsgmeeetycsmkikqnigdprradvfnprggrittlnseklpil
    rfiqmsaervvlyrnamvsphwninahsimyctggrgrvevaddrgetvfdgelrqgqll
    ivpqnfamleragsagfqlvsiktsdramvstvvglrgmpvevlmnsyrlsrdearrvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xtyB (B:)
    masssllsfslcllllchlsqaqfgssqespfqsprrsvssrnecrierlnaleptrtvr
    seagvtdyfdedneqfrcagvstirrvieprglllpsmsnaprlvyivqgrgivglvmpg
    cpetfqsfqrsereegerhrwsrdehqkvyqfqegdvlavpngfaywcynngenpvvait
    vldtsndanqldrshrqfllagrqeqgrqrygregsikenilrgfstellaaafgvnmel
    arklqcrddtrgeivraenglqvlrpsgmeeeereegrsingfeetycsmkikqnigdpr
    radvfnprggrittlnseklpilrfiqmsaervvlyrnamvsphwninahsimyctggrg
    rvevaddrgetvfdgelrqgqllivpqnfamleragsagfqlvsiktsdramvstvvgkt
    salrgmpvevlmnsyrlsrdearrvkltrgdevaiftprresraea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xtyB (B:)
    crierlnaleptrtvrseagvtdyfdedneqfrcagvstirrvieprglllpsmsnaprl
    vyivqgrgivglvmpgcpetfqsfwsrdehqkvyqfqegdvlavpngfaywcynnnpvva
    itvldtsndanqldrshrqfllagrenilrgfstellaaafgvnmelarklqcrddtrge
    ivraenglqvlrpsgfeetycsmkikqnigdprradvfnprggrittlnseklpilrfiq
    msaervvlyrnamvsphwninahsimyctggrgrvevaddrgetvfdgelrqgqllivpq
    nfamleragsagfqlvsiktsdramvstsalrgmpvevlmnsyrlsrdearrvklt