PDB entry 5xtk

View 5xtk on RCSB PDB site
Description: Crystal structure of Xanthine-guanine phosphoribosyltransferase from Yersinia pestis
Class: transferase
Keywords: transferase
Deposited on 2017-06-19, released 2018-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Xanthine phosphoribosyltransferase
    Species: Yersinia pestis [TaxId:632]
    Gene: gpt, YPO3225, y0963, YP_0708
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xtka_
  • Chain 'B':
    Compound: Xanthine phosphoribosyltransferase
    Species: Yersinia pestis [TaxId:632]
    Gene: gpt, YPO3225, y0963, YP_0708
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xtkb_
  • Heterogens: SO4, 5GP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xtkA (A:)
    mnekyvvtwdmlqiharklaqrllpaeqwkgiiavsrgglvpagilarelgiryvdtvci
    ssydhdnqrdlkvlkraegdgegfividdlvdtggtatairemypkahfvtifakpagrp
    lvddyvvdipqntwieqpwdmavtfvaplsgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xtkA (A:)
    nekyvvtwdmlqiharklaqrllpaeqwkgiiavsrgglvpagilarelgiryvdtvcis
    sydhdnqrdlkvlkraegdgegfividdlvdtggtatairemypkahfvtifakpagrpl
    vddyvvdipqntwieqpwdmavtfvaplsg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xtkB (B:)
    mnekyvvtwdmlqiharklaqrllpaeqwkgiiavsrgglvpagilarelgiryvdtvci
    ssydhdnqrdlkvlkraegdgegfividdlvdtggtatairemypkahfvtifakpagrp
    lvddyvvdipqntwieqpwdmavtfvaplsgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xtkB (B:)
    nekyvvtwdmlqiharklaqrllpaeqwkgiiavsrgglvpagilarelgiryvdtvcis
    sydhdnqrdlkvlkraegdgegfividdlvdtggtatairemypkahfvtifakpagrpl
    vddyvvdipqntwieqpwdmavtfvaplsg