PDB entry 5xtf

View 5xtf on RCSB PDB site
Description: Crystal structure of the cis-dihydrodiol naphthalene dehydrogenase NahB from Pseudomonas sp. MC1
Class: oxidoreductase
Keywords: tetramer, cis-dihydrodiol naphthalene dehydrogenase, OXIDOREDUCTASE
Deposited on 2017-06-19, released 2017-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase
    Species: Pseudomonas sp. MC1 [TaxId:1123041]
    Gene: nahB, pYIC1_37
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xtfa_
  • Chain 'B':
    Compound: 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase
    Species: Pseudomonas sp. MC1 [TaxId:1123041]
    Gene: nahB, pYIC1_37
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xtfb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xtfA (A:)
    mhhhhhhasenlyfqgamvmgnqqvvsitgagsgiglelvrsfklagycvsalvrneeqe
    allcnefkdaleivvgdvrdhatneklikqtidrfghldcfianagiwdymlnieepwek
    isssfdeifdinvksyfsgisaalpelkktngsvvmtasvsshavggggscyiaskhavl
    gmvkalayelapeirvnavspggtvtslcgpasagfdkmhmkdmpgiddmikgltplgfa
    akpedvvapylllasrkqgkfitgtvisidggmalgrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xtfA (A:)
    nqqvvsitgagsgiglelvrsfklagycvsalvrneeqeallcnefkdaleivvgdvrdh
    atneklikqtidrfghldcfianagiwdymlnieepwekisssfdeifdinvksyfsgis
    aalpelkktngsvvmtasvsshavggggscyiaskhavlgmvkalayelapeirvnavsp
    ggtvltplgfaakpedvvapylllasrkqgkfitgtvisidggmalgr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xtfB (B:)
    mhhhhhhasenlyfqgamvmgnqqvvsitgagsgiglelvrsfklagycvsalvrneeqe
    allcnefkdaleivvgdvrdhatneklikqtidrfghldcfianagiwdymlnieepwek
    isssfdeifdinvksyfsgisaalpelkktngsvvmtasvsshavggggscyiaskhavl
    gmvkalayelapeirvnavspggtvtslcgpasagfdkmhmkdmpgiddmikgltplgfa
    akpedvvapylllasrkqgkfitgtvisidggmalgrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xtfB (B:)
    gnqqvvsitgagsgiglelvrsfklagycvsalvrneeqeallcnefkdaleivvgdvrd
    hatneklikqtidrfghldcfianagiwdymlnieepwekisssfdeifdinvksyfsgi
    saalpelkktngsvvmtasvsshavggggscyiaskhavlgmvkalayelapeirvnavs
    pggtvltplgfaakpedvvapylllasrkqgkfitgtvisidggmalgr