PDB entry 5xt0

View 5xt0 on RCSB PDB site
Description: Crystal Structure of Transketolase in complex with TPP intermediate VIII from Pichia Stipitis
Class: transferase
Keywords: transketolase, TRANSFERASE
Deposited on 2017-06-16, released 2018-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: N/A
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transketolase
    Species: Scheffersomyces stipitis CBS 6054 [TaxId:322104]
    Gene: TKT, TKT1, PICST_67105
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xt0a1, d5xt0a2, d5xt0a3
  • Heterogens: CA, T6F, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xt0A (A:)
    mgsshhhhhhssglvprgshmssvdqkaistirllavdavaaansghpgaplglapaaha
    vfkkmrfnpkdtkwinrdrfvlsnghacallysmlvlygydltvedlkkfrqlgsktpgh
    pentdvpgaevttgplgqgicngvgialaqaqfaatynkpdfpisdsytyvflgdgclme
    gvsseasslaghlqlgnliafwddnkisidgstevaftedviaryksygwhivevsdadt
    ditaiaaaideakkvtnkptlvrltttigfgslaqgthgvhgaplkaddikqlktkwgfn
    peesfavpaevtasynehvaenqkiqqqwnelfaaykqkypelgaelqrrldgklpenwd
    kalpvytpadaavatrklseivlskiipevpeiiggsadltpsnltkakgtvdfqpaatg
    lgdysgryirygvrehamgaimngiaafganyknyggtflnfvsyaagavrlsalsefpi
    twvathdsiglgedgpthqpietlahfratpnisvwrpadgnetsaayksaiesthtphi
    laltrqnlpqlegssiekaskggytlvqqdkadiiivatgsevslavdalkvlegqgika
    gvvslpdqltfdkqseeyklsvlpdgvpilsvevmstfgwskyshqqfglnrfgasgkap
    eifklfeftpegvaeraaktvafykgkdvvsplrsaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xt0A (A:)
    svdqkaistirllavdavaaansghpgaplglapaahavfkkmrfnpkdtkwinrdrfvl
    snghacallysmlvlygydltvedlkkfrqlgsktpghpentdvpgaevttgplgqgicn
    gvgialaqaqfaatynkpdfpisdsytyvflgdgclmegvsseasslaghlqlgnliafw
    ddnkisidgstevaftedviaryksygwhivevsdadtditaiaaaideakkvtnkptlv
    rltttigfgslaqgthgvhgaplkaddikqlktkwgfnpeesfavpaevtasynehvaen
    qkiqqqwnelfaaykqkypelgaelqrrldgklpenwdkalpvytpadaavatrklseiv
    lskiipevpeiiggsadltpsnltkakgtvdfqpaatglgdysgryirygvrehamgaim
    ngiaafganyknyggtflnfvsyaagavrlsalsefpitwvathdsiglgedgpthqpie
    tlahfratpnisvwrpadgnetsaayksaiesthtphilaltrqnlpqlegssiekaskg
    gytlvqqdkadiiivatgsevslavdalkvlegqgikagvvslpdqltfdkqseeyklsv
    lpdgvpilsvevmstfgwskyshqqfglnrfgasgkapeifklfeftpegvaeraaktva
    fykgkdvvsplrsaf