PDB entry 5xsk

View 5xsk on RCSB PDB site
Description: Crystal structure of PWWP-DNA complex for human hepatoma-derived growth factor
Class: hormone
Keywords: Growth factor, HORMONE
Deposited on 2017-06-14, released 2018-06-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 2.84 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatoma-derived growth factor
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Hdgf
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5xska_
  • Chain 'B':
    Compound: Hepatoma-derived growth factor
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Hdgf
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5xskb_
  • Chain 'D':
    Compound: DNA (5'-d(p*tp*tp*cp*ap*ap*gp*ap*cp*cp*a)-3')
    Species: Escherichia coli BL21 [TaxId:511693]
  • Chain 'F':
    Compound: DNA (5'-d(p*tp*gp*gp*tp*cp*tp*tp*gp*ap*a)-3')
    Species: Escherichia coli BL21 [TaxId:511693]
  • Heterogens: MPD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5xskA (A:)
mgsshhhhhhssglvprgshmsrsnrqkeykcgdlvfakmkgyphwparidempeaavks
tankyqvfffgthetaflgpkdlfpyeeskekfgkpnkrkgfseglweiennptvkasgy

    Sequence, based on observed residues (ATOM records): (download) 
    >5xskA (A:)
keykcgdlvfakmkgyphwparidempeaavkstankyqvfffgthetaflgpkdlfpye
eskekfgkpnkrkgfseglweiennptvka

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >5xskB (B:)
mgsshhhhhhssglvprgshmsrsnrqkeykcgdlvfakmkgyphwparidempeaavks
tankyqvfffgthetaflgpkdlfpyeeskekfgkpnkrkgfseglweiennptvkasgy

    Sequence, based on observed residues (ATOM records): (download) 
    >5xskB (B:)
qkeykcgdlvfakmkgyphwparidempeaavkstankyqvfffgthetaflgpkdlfpy
eeskekfgkpnkrkgfseglweiennptvka

  • Chain 'D':
    No sequence available.

  • Chain 'F':
    No sequence available.