PDB entry 5xsf

View 5xsf on RCSB PDB site
Description: Crystal structure of the 2-keto-3-deoxy-6-phosphogluconate aldolase of Zymomonas mobilis ZM4 with 3-phosphoglycerate
Class: lyase
Keywords: lyase
Deposited on 2017-06-14, released 2018-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: khg/kdpg aldolase
    Species: Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) [TaxId:264203]
    Gene: eda, kdgA, ZMO0997
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00384 (1-208)
      • expression tag (0)
    Domains in SCOPe 2.07: d5xsfa1, d5xsfa2
  • Heterogens: 3PG, 3PY, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xsfA (A:)
    amrdidsvmrlapvmpvlviediadakpiaealvagglnvlevtlrtpcaleaikimkev
    pgavvgagtvlnakmldqaqeagceffvspgltadlgkhavaqkaallpgvanaadvmlg
    ldlgldrfkffpaenigglpalksmasvfrqvrfcptggitptsapkylenpsilcvggs
    wvvpagkpdvakitalakeasafkraava