PDB entry 5xse

View 5xse on RCSB PDB site
Description: Crystal structure of the 2-keto-3-deoxy-6-phosphogluconate aldolase of Zymomonas mobilis ZM4
Class: lyase
Keywords: aldolase, LYASE
Deposited on 2017-06-13, released 2018-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: khg/kdpg aldolase
    Species: Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) [TaxId:264203]
    Gene: eda, kdgA, ZMO0997
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xsea_
  • Chain 'B':
    Compound: khg/kdpg aldolase
    Species: Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) [TaxId:264203]
    Gene: eda, kdgA, ZMO0997
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xseb_
  • Chain 'C':
    Compound: khg/kdpg aldolase
    Species: Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) [TaxId:264203]
    Gene: eda, kdgA, ZMO0997
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xsec_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xseA (A:)
    mrdidsvmrlapvmpvlviediadakpiaealvagglnvlevtlrtpcaleaikimkevp
    gavvgagtvlnakmldqaqeagceffvspgltadlgkhavaqkaallpgvanaadvmlgl
    dlgldrfkffpaenigglpalksmasvfrqvrfcptggitptsapkylenpsilcvggsw
    vvpagkpdvakitalakeasafkraava
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xseB (B:)
    mrdidsvmrlapvmpvlviediadakpiaealvagglnvlevtlrtpcaleaikimkevp
    gavvgagtvlnakmldqaqeagceffvspgltadlgkhavaqkaallpgvanaadvmlgl
    dlgldrfkffpaenigglpalksmasvfrqvrfcptggitptsapkylenpsilcvggsw
    vvpagkpdvakitalakeasafkraava
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xseB (B:)
    mrdidsvmrlapvmpvlviediadakpiaealvagglnvlevtlrtpcaleaikimkevp
    gavvgagtvlnakmldqaqeagceffvspgltadlgkhavaqkaallpgvanaadvmlgl
    dlgldrfkffpaenigglpalksmasvfrqvrfcptggitptsapkylenpsilcvggsw
    vvpagkpdvakitalakeasafkraav
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5xseC (C:)
    mrdidsvmrlapvmpvlviediadakpiaealvagglnvlevtlrtpcaleaikimkevp
    gavvgagtvlnakmldqaqeagceffvspgltadlgkhavaqkaallpgvanaadvmlgl
    dlgldrfkffpaenigglpalksmasvfrqvrfcptggitptsapkylenpsilcvggsw
    vvpagkpdvakitalakeasafkraava
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xseC (C:)
    rdidsvmrlapvmpvlviediadakpiaealvagglnvlevtlrtpcaleaikimkevpg
    avvgagtvlnakmldqaqeagceffvspgltadlgkhavaqkaallpgvanaadvmlgld
    lgldrfkffpaenigglpalksmasvfrqvrfcptggitptsapkylenpsilcvggswv
    vpagkpdvakitalakeasafkraava