PDB entry 5xrw

View 5xrw on RCSB PDB site
Description: Crystal structure of flagellar motor switch complex from H. pylori
Class: motor protein
Keywords: motor switch complex, C-ring, MOTOR PROTEIN
Deposited on 2017-06-10, released 2018-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FliN
    Species: HELICOBACTER PYLORI 26695 [TaxId:85962]
    Database cross-references and differences (RAF-indexed):
    • PDB 5XRW (0-78)
  • Chain 'B':
    Compound: FliN
    Species: HELICOBACTER PYLORI 26695 [TaxId:85962]
    Database cross-references and differences (RAF-indexed):
    • PDB 5XRW (0-78)
  • Chain 'C':
    Compound: FliY
    Species: HELICOBACTER PYLORI 26695 [TaxId:85962]
    Database cross-references and differences (RAF-indexed):
    • PDB 5XRW (Start-78)
    Domains in SCOPe 2.07: d5xrwc_
  • Chain 'D':
    Compound: FliY
    Species: HELICOBACTER PYLORI 26695 [TaxId:85962]
    Database cross-references and differences (RAF-indexed):
    • PDB 5XRW (0-78)
    Domains in SCOPe 2.07: d5xrwd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5xrwC (C:)
    plgslnvkvrigqkkmilkdvvsmdigsvveldqlvndpleilvddkviakgevvivdgn
    fgiqitdigtkkerleqlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xrwC (C:)
    lgslnvkvrigqkkmilkdvvsmdigsvveldqlvndpleilvddkviakgevvivdgnf
    giqitdigtkkerleqlk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xrwD (D:)
    plgslnvkvrigqkkmilkdvvsmdigsvveldqlvndpleilvddkviakgevvivdgn
    fgiqitdigtkkerleqlk