PDB entry 5xrt

View 5xrt on RCSB PDB site
Description: Crystal structure of A/Minnesota/11/2010 (H3N2) influenza virus hemagglutinin
Class: viral protein
Keywords: influenza virus, hemagglutinin, receptor binding, antigen protein, VIRAL PROTEIN
Deposited on 2017-06-09, released 2018-07-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-09.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/swine/Minnesota/A01134337/2010(H3N2)) [TaxId:1159784]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5xrta_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1341145]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5xrtb_
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/swine/Minnesota/A01134337/2010(H3N2)) [TaxId:1159784]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5xrtc_
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1341145]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5xrtd_
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/swine/Minnesota/A01134337/2010(H3N2)) [TaxId:1159784]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5xrte_
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1341145]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5xrtf_
  • Chain 'G':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/swine/Minnesota/A01134337/2010(H3N2)) [TaxId:1159784]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5xrtg_
  • Chain 'H':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1341145]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5xrth_
  • Heterogens: NAG, CAC

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xrtA (A:)
    qklpgsdnsmatlclghhavpngtlvktitddqievtnatelvqssstgricnsphqild
    gknctlidallgdphcddfqnkewdlfverstaysncypyyvpdyatlrslvassgnlef
    tqesfnwtgvaqdgssyacrrgsvnsffsrlnwlynlnykypeqnvtmpnndkfdklyiw
    gvhhpgtdkdqtnlyvqasgrvivstkrsqqtvipnigsrpwvrgvssiisiywtivkpg
    dillinstgnliaprgyfkiqsgkssimrsdahidecnsecitpngsipndkpfqnvnki
    tygacpryvkqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xrtA (A:)
    nsmatlclghhavpngtlvktitddqievtnatelvqssstgricnsphqildgknctli
    dallgdphcddfqnkewdlfverstaysncypyyvpdyatlrslvassgnleftqesfnw
    tgvaqdgssyacrrgsvnsffsrlnwlynlnykypeqnvtmpnndkfdklyiwgvhhpgt
    dkdqtnlyvqasgrvivstkrsqqtvipnigsrpwvrgvssiisiywtivkpgdillins
    tgnliaprgyfkiqsgkssimrsdahidecnsecitpngsipndkpfqnvnkitygacpr
    yvkqntlklatgmrnvpek
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xrtB (B:)
    gifgaiagfiengwegmvdgwygfrhqnsegtgqaadlkstqaainqitgklnrvikktn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemsklfe
    rtrrqlrenaedmgngcfkiyhkcdnacigsirngtydhdiyrnealnnrfqik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5xrtC (C:)
    qklpgsdnsmatlclghhavpngtlvktitddqievtnatelvqssstgricnsphqild
    gknctlidallgdphcddfqnkewdlfverstaysncypyyvpdyatlrslvassgnlef
    tqesfnwtgvaqdgssyacrrgsvnsffsrlnwlynlnykypeqnvtmpnndkfdklyiw
    gvhhpgtdkdqtnlyvqasgrvivstkrsqqtvipnigsrpwvrgvssiisiywtivkpg
    dillinstgnliaprgyfkiqsgkssimrsdahidecnsecitpngsipndkpfqnvnki
    tygacpryvkqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xrtC (C:)
    nsmatlclghhavpngtlvktitddqievtnatelvqssstgricnsphqildgknctli
    dallgdphcddfqnkewdlfverstaysncypyyvpdyatlrslvassgnleftqesfnw
    tgvaqdgssyacrrgsvnsffsrlnwlynlnykypeqnvtmpnndkfdklyiwgvhhpgt
    dkdqtnlyvqasgrvivstkrsqqtvipnigsrpwvrgvssiisiywtivkpgdillins
    tgnliaprgyfkiqsgkssimrsdahidecnsecitpngsipndkpfqnvnkitygacpr
    yvkqntlklatgmrnvpek
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xrtD (D:)
    gifgaiagfiengwegmvdgwygfrhqnsegtgqaadlkstqaainqitgklnrvikktn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemsklfe
    rtrrqlrenaedmgngcfkiyhkcdnacigsirngtydhdiyrnealnnrfqik
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5xrtE (E:)
    qklpgsdnsmatlclghhavpngtlvktitddqievtnatelvqssstgricnsphqild
    gknctlidallgdphcddfqnkewdlfverstaysncypyyvpdyatlrslvassgnlef
    tqesfnwtgvaqdgssyacrrgsvnsffsrlnwlynlnykypeqnvtmpnndkfdklyiw
    gvhhpgtdkdqtnlyvqasgrvivstkrsqqtvipnigsrpwvrgvssiisiywtivkpg
    dillinstgnliaprgyfkiqsgkssimrsdahidecnsecitpngsipndkpfqnvnki
    tygacpryvkqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xrtE (E:)
    nsmatlclghhavpngtlvktitddqievtnatelvqssstgricnsphqildgknctli
    dallgdphcddfqnkewdlfverstaysncypyyvpdyatlrslvassgnleftqesfnw
    tgvaqdgssyacrrgsvnsffsrlnwlynlnykypeqnvtmpnndkfdklyiwgvhhpgt
    dkdqtnlyvqasgrvivstkrsqqtvipnigsrpwvrgvssiisiywtivkpgdillins
    tgnliaprgyfkiqsgkssimrsdahidecnsecitpngsipndkpfqnvnkitygacpr
    yvkqntlklatgmrnvpek
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xrtF (F:)
    gifgaiagfiengwegmvdgwygfrhqnsegtgqaadlkstqaainqitgklnrvikktn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemsklfe
    rtrrqlrenaedmgngcfkiyhkcdnacigsirngtydhdiyrnealnnrfqik
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5xrtG (G:)
    qklpgsdnsmatlclghhavpngtlvktitddqievtnatelvqssstgricnsphqild
    gknctlidallgdphcddfqnkewdlfverstaysncypyyvpdyatlrslvassgnlef
    tqesfnwtgvaqdgssyacrrgsvnsffsrlnwlynlnykypeqnvtmpnndkfdklyiw
    gvhhpgtdkdqtnlyvqasgrvivstkrsqqtvipnigsrpwvrgvssiisiywtivkpg
    dillinstgnliaprgyfkiqsgkssimrsdahidecnsecitpngsipndkpfqnvnki
    tygacpryvkqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xrtG (G:)
    nsmatlclghhavpngtlvktitddqievtnatelvqssstgricnsphqildgknctli
    dallgdphcddfqnkewdlfverstaysncypyyvpdyatlrslvassgnleftqesfnw
    tgvaqdgssyacrrgsvnsffsrlnwlynlnykypeqnvtmpnndkfdklyiwgvhhpgt
    dkdqtnlyvqasgrvivstkrsqqtvipnigsrpwvrgvssiisiywtivkpgdillins
    tgnliaprgyfkiqsgkssimrsdahidecnsecitpngsipndkpfqnvnkitygacpr
    yvkqntlklatgmrnvpek
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xrtH (H:)
    gifgaiagfiengwegmvdgwygfrhqnsegtgqaadlkstqaainqitgklnrvikktn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemsklfe
    rtrrqlrenaedmgngcfkiyhkcdnacigsirngtydhdiyrnealnnrfqik