PDB entry 5xrs

View 5xrs on RCSB PDB site
Description: Crystal structure of A/Minnesota/11/2010 (H3N2) influenza virus hemagglutinin in complex with LSTc
Class: viral protein
Keywords: influenza virus, hemagglutinin, human receptor analog, LSTc, VIRAL PROTEIN
Deposited on 2017-06-09, released 2018-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-25, with a file datestamp of 2018-07-20.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/swine/Minnesota/A01134337/2010(H3N2)) [TaxId:1159784]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xrsa_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/swine/Minnesota/A01134337/2010(H3N2)) [TaxId:1159784]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xrsb_
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/swine/Minnesota/A01134337/2010(H3N2)) [TaxId:1159784]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xrsc_
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/swine/Minnesota/A01134337/2010(H3N2)) [TaxId:1159784]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xrsd_
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/swine/Minnesota/A01134337/2010(H3N2)) [TaxId:1159784]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xrse_
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/swine/Minnesota/A01134337/2010(H3N2)) [TaxId:1159784]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xrsf_
  • Chain 'G':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/swine/Minnesota/A01134337/2010(H3N2)) [TaxId:1159784]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xrsg_
  • Chain 'H':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/swine/Minnesota/A01134337/2010(H3N2)) [TaxId:1159784]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xrsh_
  • Heterogens: NAG, FUC, FUL, BMA, MAN, SIA, GAL, BGC, CAC

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xrsA (A:)
    qklpgsdnsmatlclghhavpngtlvktitddqievtnatelvqssstgricnsphqild
    gknctlidallgdphcddfqnkewdlfverstaysncypyyvpdyatlrslvassgnlef
    tqesfnwtgvaqdgssyacrrgsvnsffsrlnwlynlnykypeqnvtmpnndkfdklyiw
    gvhhpgtdkdqtnlyvqasgrvivstkrsqqtvipnigsrpwvrgvssiisiywtivkpg
    dillinstgnliaprgyfkiqsgkssimrsdahidecnsecitpngsipndkpfqnvnki
    tygacpryvkqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xrsA (A:)
    nsmatlclghhavpngtlvktitddqievtnatelvqssstgricnsphqildgknctli
    dallgdphcddfqnkewdlfverstaysncypyyvpdyatlrslvassgnleftqesfnw
    tgvaqdgssyacrrgsvnsffsrlnwlynlnykypeqnvtmpnndkfdklyiwgvhhpgt
    dkdqtnlyvqasgrvivstkrsqqtvipnigsrpwvrgvssiisiywtivkpgdillins
    tgnliaprgyfkiqsgkssimrsdahidecnsecitpngsipndkpfqnvnkitygacpr
    yvkqntlklatgmrnvpek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xrsB (B:)
    gifgaiagfiengwegmvdgwygfrhqnsegtgqaadlkstqaainqitgklnrvikktn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemsklfe
    rtrrqlrenaedmgngcfkiyhkcdnacigsirngtydhdiyrnealnnrfqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xrsB (B:)
    gifgaiagfiengwegmvdgwygfrhqnsegtgqaadlkstqaainqitgklnrvikktn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemsklfe
    rtrrqlrenaedmgngcfkiyhkcdnacigsirngtydhdiyrnealnnrfq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5xrsC (C:)
    qklpgsdnsmatlclghhavpngtlvktitddqievtnatelvqssstgricnsphqild
    gknctlidallgdphcddfqnkewdlfverstaysncypyyvpdyatlrslvassgnlef
    tqesfnwtgvaqdgssyacrrgsvnsffsrlnwlynlnykypeqnvtmpnndkfdklyiw
    gvhhpgtdkdqtnlyvqasgrvivstkrsqqtvipnigsrpwvrgvssiisiywtivkpg
    dillinstgnliaprgyfkiqsgkssimrsdahidecnsecitpngsipndkpfqnvnki
    tygacpryvkqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xrsC (C:)
    nsmatlclghhavpngtlvktitddqievtnatelvqssstgricnsphqildgknctli
    dallgdphcddfqnkewdlfverstaysncypyyvpdyatlrslvassgnleftqesfnw
    tgvaqdgssyacrrgsvnsffsrlnwlynlnykypeqnvtmpnndkfdklyiwgvhhpgt
    dkdqtnlyvqasgrvivstkrsqqtvipnigsrpwvrgvssiisiywtivkpgdillins
    tgnliaprgyfkiqsgkssimrsdahidecnsecitpngsipndkpfqnvnkitygacpr
    yvkqntlklatgmrnvpek
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5xrsD (D:)
    gifgaiagfiengwegmvdgwygfrhqnsegtgqaadlkstqaainqitgklnrvikktn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemsklfe
    rtrrqlrenaedmgngcfkiyhkcdnacigsirngtydhdiyrnealnnrfqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xrsD (D:)
    gifgaiagfiengwegmvdgwygfrhqnsegtgqaadlkstqaainqitgklnrvikktn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemsklfe
    rtrrqlrenaedmgngcfkiyhkcdnacigsirngtydhdiyrnealnnrfq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5xrsE (E:)
    qklpgsdnsmatlclghhavpngtlvktitddqievtnatelvqssstgricnsphqild
    gknctlidallgdphcddfqnkewdlfverstaysncypyyvpdyatlrslvassgnlef
    tqesfnwtgvaqdgssyacrrgsvnsffsrlnwlynlnykypeqnvtmpnndkfdklyiw
    gvhhpgtdkdqtnlyvqasgrvivstkrsqqtvipnigsrpwvrgvssiisiywtivkpg
    dillinstgnliaprgyfkiqsgkssimrsdahidecnsecitpngsipndkpfqnvnki
    tygacpryvkqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xrsE (E:)
    nsmatlclghhavpngtlvktitddqievtnatelvqssstgricnsphqildgknctli
    dallgdphcddfqnkewdlfverstaysncypyyvpdyatlrslvassgnleftqesfnw
    tgvaqdgssyacrrgsvnsffsrlnwlynlnykypeqnvtmpnndkfdklyiwgvhhpgt
    dkdqtnlyvqasgrvivstkrsqqtvipnigsrpwvrgvssiisiywtivkpgdillins
    tgnliaprgyfkiqsgkssimrsdahidecnsecitpngsipndkpfqnvnkitygacpr
    yvkqntlklatgmrnvpek
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5xrsF (F:)
    gifgaiagfiengwegmvdgwygfrhqnsegtgqaadlkstqaainqitgklnrvikktn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemsklfe
    rtrrqlrenaedmgngcfkiyhkcdnacigsirngtydhdiyrnealnnrfqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xrsF (F:)
    gifgaiagfiengwegmvdgwygfrhqnsegtgqaadlkstqaainqitgklnrvikktn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemsklfe
    rtrrqlrenaedmgngcfkiyhkcdnacigsirngtydhdiyrnealnnrfq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5xrsG (G:)
    qklpgsdnsmatlclghhavpngtlvktitddqievtnatelvqssstgricnsphqild
    gknctlidallgdphcddfqnkewdlfverstaysncypyyvpdyatlrslvassgnlef
    tqesfnwtgvaqdgssyacrrgsvnsffsrlnwlynlnykypeqnvtmpnndkfdklyiw
    gvhhpgtdkdqtnlyvqasgrvivstkrsqqtvipnigsrpwvrgvssiisiywtivkpg
    dillinstgnliaprgyfkiqsgkssimrsdahidecnsecitpngsipndkpfqnvnki
    tygacpryvkqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xrsG (G:)
    nsmatlclghhavpngtlvktitddqievtnatelvqssstgricnsphqildgknctli
    dallgdphcddfqnkewdlfverstaysncypyyvpdyatlrslvassgnleftqesfnw
    tgvaqdgssyacrrgsvnsffsrlnwlynlnykypeqnvtmpnndkfdklyiwgvhhpgt
    dkdqtnlyvqasgrvivstkrsqqtvipnigsrpwvrgvssiisiywtivkpgdillins
    tgnliaprgyfkiqsgkssimrsdahidecnsecitpngsipndkpfqnvnkitygacpr
    yvkqntlklatgmrnvpekqt
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5xrsH (H:)
    gifgaiagfiengwegmvdgwygfrhqnsegtgqaadlkstqaainqitgklnrvikktn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemsklfe
    rtrrqlrenaedmgngcfkiyhkcdnacigsirngtydhdiyrnealnnrfqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xrsH (H:)
    gifgaiagfiengwegmvdgwygfrhqnsegtgqaadlkstqaainqitgklnrvikktn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemsklfe
    rtrrqlrenaedmgngcfkiyhkcdnacigsirngtydhdiyrnealnnrfq