PDB entry 5xrf

View 5xrf on RCSB PDB site
Description: Crystal structure of Da-36, a thrombin-like enzyme from Deinagkistrodon acutus
Class: hydrolase
Keywords: thrombin-like enzyme, snake venom, Deinagkistrodon acutus, HYDROLASE
Deposited on 2017-06-08, released 2018-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Snake venom serine protease Da-36
    Species: Deinagkistrodon acutus [TaxId:36307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xrfa_
  • Heterogens: NAG, BMA, FUC, MAN, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xrfA (A:)
    qksselviggnecdtnehrflaafftsrpwtfqcagtliheewvlaaahcykrglniylg
    mhnqsiqfddeqrryaieehyyrcdekltkwekdvvllklnkpvsnsthiaplslpsspp
    sigsvcrvmgwgimsstkdilpdvphcaninllnymecvahypdvpettrllcagvlegg
    idtcnqdsggplicdgqfqgivffgkypcaqpnkpglytrvsnyndwiqniiagktttac
    pp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xrfA (A:)
    viggnecdtnehrflaafftsrpwtfqcagtliheewvlaaahcykrglniylgmhnqsi
    qfddeqrryaieehyyrcdekltkwekdvvllklnkpvsnsthiaplslpssppsigsvc
    rvmgwgimsstkdilpdvphcaninllnymecvahypdvpettrllcagvleggidtcnq
    dsggplicdgqfqgivffgkypcaqpnkpglytrvsnyndwiqniiagktttacpp