PDB entry 5xr6

View 5xr6 on RCSB PDB site
Description: Crystal structure of RabA1a in complex with GppNHp
Class: protein transport
Keywords: GTPase, G-protein, Cellular transportation, Arabidopsis thaliana, PROTEIN TRANSPORT
Deposited on 2017-06-07, released 2018-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein RABA1a
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: RABA1A, ARA-2, RAB11E, At1g06400, T2D23.10, T2D23_5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28185 (21-End)
      • expression tag (19-20)
    Domains in SCOPe 2.07: d5xr6a1, d5xr6a2
  • Chain 'B':
    Compound: Ras-related protein RABA1a
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: RABA1A, ARA-2, RAB11E, At1g06400, T2D23.10, T2D23_5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28185 (21-End)
      • expression tag (19-20)
    Domains in SCOPe 2.07: d5xr6b1, d5xr6b2
  • Heterogens: GNP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xr6A (A:)
    mgsshhhhhhssglvprgshmydylfklvligdsgvgksnllsrftknefnleskstigv
    efatkttkvegkvvkaqiwdtagqeryraitsayyrgavgalliydvtrhatfenaarwl
    relrghtdpnivvmlignkcdlrhlvavkteeakafaereslyfmetsaldatnvenaft
    evltqihkivskrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xr6A (A:)
    hmydylfklvligdsgvgksnllsrftknefnleskstigvefatkttkvegkvvkaqiw
    dtagqeraitsayyrgavgalliydvtrhatfenaarwlrelrghtdpnivvmlignkcd
    lrhlvavkteeakafaereslyfmetsaldatnvenaftevltqihkivs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xr6B (B:)
    mgsshhhhhhssglvprgshmydylfklvligdsgvgksnllsrftknefnleskstigv
    efatkttkvegkvvkaqiwdtagqeryraitsayyrgavgalliydvtrhatfenaarwl
    relrghtdpnivvmlignkcdlrhlvavkteeakafaereslyfmetsaldatnvenaft
    evltqihkivskrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xr6B (B:)
    hmydylfklvligdsgvgksnllsrftknefnleskstigvefatkttkvegkvvkaqiw
    dtagqeraitsayyrgavgalliydvtrhatfenaarwlrelrghtdpnivvmlignkcd
    lrhlvavkteeakafaereslyfmetsaldatnvenaftevltqihkivs