PDB entry 5xr3

View 5xr3 on RCSB PDB site
Description: SAV0551 with glyoxylate
Class: chaperone
Keywords: Hsp31, chaperone, glyoxalase III
Deposited on 2017-06-08, released 2017-11-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein/nucleic acid deglycase HchA
    Species: Staphylococcus aureus (strain Mu50 / ATCC 700699) [TaxId:158878]
    Gene: hchA, SAV0551
    Database cross-references and differences (RAF-indexed):
    • Uniprot P64312 (Start-291)
      • expression tag (292)
    Domains in SCOPe 2.07: d5xr3a1, d5xr3a2
  • Chain 'B':
    Compound: Protein/nucleic acid deglycase HchA
    Species: Staphylococcus aureus (strain Mu50 / ATCC 700699) [TaxId:158878]
    Gene: hchA, SAV0551
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xr3b_
  • Chain 'C':
    Compound: Protein/nucleic acid deglycase HchA
    Species: Staphylococcus aureus (strain Mu50 / ATCC 700699) [TaxId:158878]
    Gene: hchA, SAV0551
    Database cross-references and differences (RAF-indexed):
    • Uniprot P64312 (Start-291)
      • expression tag (292-294)
    Domains in SCOPe 2.07: d5xr3c1, d5xr3c2
  • Chain 'D':
    Compound: Protein/nucleic acid deglycase HchA
    Species: Staphylococcus aureus (strain Mu50 / ATCC 700699) [TaxId:158878]
    Gene: hchA, SAV0551
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xr3d_
  • Chain 'E':
    Compound: Protein/nucleic acid deglycase HchA
    Species: Staphylococcus aureus (strain Mu50 / ATCC 700699) [TaxId:158878]
    Gene: hchA, SAV0551
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xr3e_
  • Chain 'F':
    Compound: Protein/nucleic acid deglycase HchA
    Species: Staphylococcus aureus (strain Mu50 / ATCC 700699) [TaxId:158878]
    Gene: hchA, SAV0551
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xr3f_
  • Chain 'G':
    Compound: Protein/nucleic acid deglycase HchA
    Species: Staphylococcus aureus (strain Mu50 / ATCC 700699) [TaxId:158878]
    Gene: hchA, SAV0551
    Database cross-references and differences (RAF-indexed):
    • Uniprot P64312 (Start-291)
      • expression tag (292-295)
    Domains in SCOPe 2.07: d5xr3g1, d5xr3g2
  • Chain 'H':
    Compound: Protein/nucleic acid deglycase HchA
    Species: Staphylococcus aureus (strain Mu50 / ATCC 700699) [TaxId:158878]
    Gene: hchA, SAV0551
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xr3h_
  • Heterogens: GLV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xr3A (A:)
    msqdvnelskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaa
    eeryvllengkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeav
    istynklkeklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwal
    dndrfivtlxhgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlva
    dlltkqglkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnaiqnklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xr3A (A:)
    lskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaaeeryvll
    engkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeavistynkl
    keklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwaldndrfiv
    tlxhgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlvadlltkqg
    lkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnaiqnkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xr3B (B:)
    msqdvnelskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaa
    eeryvllengkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeav
    istynklkeklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwal
    dndrfivtlxhgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlva
    dlltkqglkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnaiqnklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xr3B (B:)
    dvnelskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaaeer
    yvllengkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeavist
    ynklkeklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwaldnd
    rfivtlxhgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlvadll
    tkqglkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnaiq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5xr3C (C:)
    msqdvnelskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaa
    eeryvllengkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeav
    istynklkeklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwal
    dndrfivtlxhgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlva
    dlltkqglkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnaiqnklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xr3C (C:)
    nelskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaaeeryv
    llengkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeavistyn
    klkeklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwaldndrf
    ivtlxhgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlvadlltk
    qglkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnaiqnkleh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5xr3D (D:)
    msqdvnelskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaa
    eeryvllengkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeav
    istynklkeklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwal
    dndrfivtlxhgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlva
    dlltkqglkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnaiqnklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xr3D (D:)
    elskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaaeeryvl
    lengkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeavistynk
    lkeklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwaldndrfi
    vtlxhgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlvadlltkq
    glkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnaiq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5xr3E (E:)
    msqdvnelskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaa
    eeryvllengkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeav
    istynklkeklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwal
    dndrfivtlxhgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlva
    dlltkqglkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnaiqnklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xr3E (E:)
    lskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaaeeryvll
    engkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeavistynkl
    keklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwaldndrfiv
    tlxhgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlvadlltkqg
    lkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnaiqnk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5xr3F (F:)
    msqdvnelskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaa
    eeryvllengkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeav
    istynklkeklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwal
    dndrfivtlxhgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlva
    dlltkqglkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnaiqnklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xr3F (F:)
    elskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaaeeryvl
    lengkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeavistynk
    lkeklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwaldndrfi
    vtlxhgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlvadlltkq
    glkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnaiq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5xr3G (G:)
    msqdvnelskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaa
    eeryvllengkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeav
    istynklkeklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwal
    dndrfivtlxhgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlva
    dlltkqglkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnaiqnklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xr3G (G:)
    vnelskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaaeery
    vllengkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeavisty
    nklkeklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwaldndr
    fivtlxhgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlvadllt
    kqglkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnaiqnklehh
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5xr3H (H:)
    msqdvnelskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaa
    eeryvllengkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeav
    istynklkeklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwal
    dndrfivtlxhgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlva
    dlltkqglkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnaiqnklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xr3H (H:)
    nelskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaaeeryv
    llengkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeavistyn
    klkeklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwaldndrf
    ivtlxhgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlvadlltk
    qglkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnaiqnk