PDB entry 5xqv

View 5xqv on RCSB PDB site
Description: Crystal structure of Notched-fin eelpout type III antifreeze protein A20L mutant (NFE6, AFP), P21 form
Class: antifreeze protein
Keywords: Type III, Notched-fin eelpout, ANTIFREEZE PROTEIN
Deposited on 2017-06-07, released 2018-05-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-06, with a file datestamp of 2018-06-01.
Experiment type: XRAY
Resolution: 0.97 Å
R-factor: N/A
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ice-structuring protein
    Species: Zoarces elongatus [TaxId:291231]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53UJ4 (1-66)
      • engineered mutation (19)
    Domains in SCOPe 2.08: d5xqva_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xqvA (A:)
    mgesvvatqlipintaltplmmegkvtnpsgipfaemsqivgkqvntpvakgqtlmpgmv
    ktyvpak
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xqvA (A:)
    gesvvatqlipintaltplmmegkvtnpsgipfaemsqivgkqvntpvakgqtlmpgmvk
    tyvpak