PDB entry 5xqu

View 5xqu on RCSB PDB site
Description: Crystal structure of Notched-fin eelpout type III antifreeze protein A20I mutant (NFE6, AFP), P212121 form
Class: antifreeze protein
Keywords: antifreeze protein
Deposited on 2017-06-07, released 2018-05-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-06, with a file datestamp of 2018-06-01.
Experiment type: XRAY
Resolution: 1 Å
R-factor: N/A
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ice-structuring protein
  Species: Zoarces elongatus [TaxId:291231]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q53UJ4 (1-End)
    • engineered mutation (19)
  Domains in SCOPe 2.08: d5xqua_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >5xquA (A:)
  mgesvvatqlipintaltpimmegkvtnpsgipfaemsqivgkqvntpvakgqtlmpgmv
  ktyvpak
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >5xquA (A:)
  gesvvatqlipintaltpimmegkvtnpsgipfaemsqivgkqvntpvakgqtlmpgmvk
  tyvpa