PDB entry 5xqp

View 5xqp on RCSB PDB site
Description: Crystal structure of Notched-fin eelpout type III antifreeze protein (NFE6, AFP), P212121 form
Class: antifreeze protein
Keywords: antifreeze protein
Deposited on 2017-06-07, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 1 Å
R-factor: N/A
AEROSPACI score: 0.83 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ice-structuring protein
    Species: Zoarces elongatus [TaxId:291231]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xqpa_
  • Chain 'B':
    Compound: Ice-structuring protein
    Species: Zoarces elongatus [TaxId:291231]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xqpb_
  • Chain 'C':
    Compound: Ice-structuring protein
    Species: Zoarces elongatus [TaxId:291231]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xqpc_
  • Chain 'D':
    Compound: Ice-structuring protein
    Species: Zoarces elongatus [TaxId:291231]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xqpd_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xqpA (A:)
    mgesvvatqlipintaltpammegkvtnpsgipfaemsqivgkqvntpvakgqtlmpgmv
    ktyvpak
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xqpA (A:)
    gesvvatqlipintaltpammegkvtnpsgipfaemsqivgkqvntpvakgqtlmpgmvk
    tyvpa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xqpB (B:)
    mgesvvatqlipintaltpammegkvtnpsgipfaemsqivgkqvntpvakgqtlmpgmv
    ktyvpak
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xqpB (B:)
    gesvvatqlipintaltpammegkvtnpsgipfaemsqivgkqvntpvakgqtlmpgmvk
    tyvpa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5xqpC (C:)
    mgesvvatqlipintaltpammegkvtnpsgipfaemsqivgkqvntpvakgqtlmpgmv
    ktyvpak
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xqpC (C:)
    gesvvatqlipintaltpammegkvtnpsgipfaemsqivgkqvntpvakgqtlmpgmvk
    tyvp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5xqpD (D:)
    mgesvvatqlipintaltpammegkvtnpsgipfaemsqivgkqvntpvakgqtlmpgmv
    ktyvpak
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xqpD (D:)
    gesvvatqlipintaltpammegkvtnpsgipfaemsqivgkqvntpvakgqtlmpgmvk
    tyvpa