PDB entry 5xq5

View 5xq5 on RCSB PDB site
Description: NMR structure of the domain 5 of the E. coli ribosomal protein S1
Class: ribosomal protein
Keywords: S1 RNA-binding domain, E. coli ribosomal protein, NMR solution structure, RIBOSOMAL PROTEIN
Deposited on 2017-06-06, released 2018-06-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-06, with a file datestamp of 2018-06-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 30S ribosomal protein S1
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: rpsA, ssyF, b0911, JW0894
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5xq5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xq5A (A:)
    mkanpwqqfaethnkgdrvegkiksitdfgifigldggidglvhlsdiswnvageeavre
    ykkgdeiaavvlqvdaererislgvkqlaedpfnnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xq5A (A:)
    kanpwqqfaethnkgdrvegkiksitdfgifigldggidglvhlsdiswnvageeavrey
    kkgdeiaavvlqvdaererislgvkqlaedpfnn