PDB entry 5xpx

View 5xpx on RCSB PDB site
Description: Structure elucidation of truncated AMS3 lipase from an Antarctic Pseudomonas
Class: hydrolase
Keywords: hydrolase
Deposited on 2017-06-05, released 2018-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 2.77 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipase
    Species: Pseudomonas sp. A3(2015c) [TaxId:1680634]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xpxa_
  • Chain 'E':
    Compound: Lipase
    Species: Pseudomonas sp. A3(2015c) [TaxId:1680634]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xpxe_
  • Heterogens: ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xpxA (A:)
    maswshpqfekgaddddkvprgsaslrandapivllhgftgwgreemfgfkywggvrgdi
    eqwlndngyrtytlavgplssnwdraceayaqlvggtvdygaahaakhgharfgrtypgl
    lpelkrggrihiiahsqggqtarmlvsllengsqeereyakahnvslsplfegghhfvls
    vttiatphdgttlvnmvdftdrffdlqkavleaaavasnvpytsqvydfkldqwglrrqp
    gesfdhyferlkrspvwtstdtarydlsvsgaeklnqwvqaspntyylsfstertyrgal
    tgnhypelgmnafsavvcapflgsyrnptlgiddrwlendgivntvsmngpkrgssdriv
    pydgtlkkgvwndmgtynvdhleiigvdpnpsfdirafylrlaeqlaslrppgfssisah
    hhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xpxA (A:)
    randapivllhgftgwgreemfgfkywggvrgdieqwlndngyrtytlavgplssnwdra
    ceayaqlvggtvdygaahaakhgharfgrtypgllpelkrggrihiiahsqggqtarmlv
    sllengsqeereyakahnvslsplfegghhfvlsvttiatphdgttlvnmvdftdrffdl
    qkavleaaavasnvpytsqvydfkldqwglrrqpgesfdhyferlkrspvwtstdtaryd
    lsvsgaeklnqwvqaspntyylsfstertyrgaltgnhypelgmnafsavvcapflgsyr
    nptlgiddrwlendgivntvsmngpkrgssdrivpydgtlkkgvwndmgtynvdhleiig
    vdpnpsfdirafylrlaeqlaslr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5xpxE (E:)
    maswshpqfekgaddddkvprgsaslrandapivllhgftgwgreemfgfkywggvrgdi
    eqwlndngyrtytlavgplssnwdraceayaqlvggtvdygaahaakhgharfgrtypgl
    lpelkrggrihiiahsqggqtarmlvsllengsqeereyakahnvslsplfegghhfvls
    vttiatphdgttlvnmvdftdrffdlqkavleaaavasnvpytsqvydfkldqwglrrqp
    gesfdhyferlkrspvwtstdtarydlsvsgaeklnqwvqaspntyylsfstertyrgal
    tgnhypelgmnafsavvcapflgsyrnptlgiddrwlendgivntvsmngpkrgssdriv
    pydgtlkkgvwndmgtynvdhleiigvdpnpsfdirafylrlaeqlaslrppgfssisah
    hhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xpxE (E:)
    dapivllhgftgwgreemfgfkywggvrgdieqwlndngyrtytlavgplssnwdracea
    yaqlvggtvdygaahaakhgharfgrtypgllpelkrggrihiiahsqggqtarmlvsll
    engsqeereyakahnvslsplfegghhfvlsvttiatphdgttlvnmvdftdrffdlqka
    vleaaavasnvpytsqvydfkldqwglrrqpgesfdhyferlkrspvwtstdtarydlsv
    sgaeklnqwvqaspntyylsfstertyrgaltgnhypelgmnafsavvcapflgsyrnpt
    lgiddrwlendgivntvsmngpkrgssdrivpydgtlkkgvwndmgtynvdhleiigvdp
    npsfdirafylrlaeqlaslr