PDB entry 5xp9

View 5xp9 on RCSB PDB site
Description: Crystal structure of Bismuth bound NDM-1
Class: hydrolase
Keywords: antibiotics resistance, beta-lactamase, metallodrug, Bismuth, HYDROLASE
Deposited on 2017-06-01, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metallo-beta-lactamase type 2
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: blaNDM-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xp9a_
  • Heterogens: BS3, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xp9A (A:)
    sgeirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvl
    vvdtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnq
    lapqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafgg
    clikdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmad
    klr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xp9A (A:)
    dqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqil
    nwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhslt
    faangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnlg
    dadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr