PDB entry 5xoh

View 5xoh on RCSB PDB site
Description: Crystal structure of bergaptol o-methyltransferase complex
Class: transferase
Keywords: bergaptol o-methyltransferase, TRANSFERASE
Deposited on 2017-05-28, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bergaptol O-methyltransferase
    Species: Peucedanum praeruptorum [TaxId:312531]
    Gene: BMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xoha1, d5xoha2
  • Heterogens: SAH, 8B6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xohA (A:)
    magmktspsqdeeacvlaiqlatstvlpmilksaieldilntiskagpgnylspsdlask
    llmsnphapimlerilrvlatykvlgckpselsdgevewlycwtpvckflsnnedgasia
    plllvhqdqvpmkswyhltdaildggtafnkaygmnifdyasqdpqfnkvfnrsmaghst
    itmkkiletyngfeglksivdvgggsgatlnmiiskyptikginfdlphvvgdspihpgv
    ehvggdmfasvpkgdaiflkwifhswsdedclrilkncyealadnkkvivaefiipevpg
    gsddatksvvhldavmlayvpggkertekefealatsagfksfrkvccafntwimefsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xohA (A:)
    psqdeeacvlaiqlatstvlpmilksaieldilntiskagpgnylspsdlaskllmsnph
    apimlerilrvlatykvlgckpselsdgevewlycwtpvckflsnnedgasiaplllvhq
    dqvpmkswyhltdaildggtafnkaygmnifdyasqdpqfnkvfnrsmaghstitmkkil
    etyngfeglksivdvgggsgatlnmiiskyptikginfdlphvvgdspihpgvehvggdm
    fasvpkgdaiflkwifhswsdedclrilkncyealadnkkvivaefiipevpggsddatk
    svvhldavmlayvpggkertekefealatsagfksfrkvccafntwim