PDB entry 5xoe

View 5xoe on RCSB PDB site
Description: Crystal Structure of the apo Staphylococcus aureus phosphofructokinase
Class: transferase
Keywords: Staphylococcus aureus, phosphofructokinase, TRANSFERASE
Deposited on 2017-05-27, released 2018-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 2.98 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent 6-phosphofructokinase
    Species: Staphylococcus aureus (strain bovine RF122 / ET3-1) [TaxId:273036]
    Gene: pfkA, SAB1557c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xoea_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xoeA (A:)
    mkkiavltsggdspgmnaavravvrtaiyneievygvyhgyqgllnddihklelgsvgdt
    iqrggtflysarcpefkeqevrkvaienlrkrgieglvviggdgsyrgaqriseeckeiq
    tigipgtidndingtdftigfdtalntiiglvdkirdtasshartfiieamgrdcgdlal
    waglsvgaetivvpevktdikeiadkieqgikrgkkhsivlvaegcmtaqdcqkelsqyi
    nvdnrvsvlghvqrggsptgadrvlasrlggyavdllmqgetakgvgiknnkivatsfde
    ifdgkdhkfdyslyelanklsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xoeA (A:)
    mkkiavltsggdspgmnaavravvrtaiyneievygvyhgyqgllnddihklelgsvgdt
    iqrggtflysarcpefkeqevrkvaienlrkrgieglvviggdgsyrgaqriseeckeiq
    tigipgtidndingtdftigfdtalntiiglvdkirdtasshartfiieamgrdcgdlal
    waglsvgaetivvpevktdikeiadkieqgikrgkkhsivlvaegcmtaqdcqkelsqyi
    nvdnrvsvlghvqrggsptgadrvlasrlggyavdllmqgetakgvgiknnkivatsfde
    ifdkfdyslyelanklsi