PDB entry 5xoc

View 5xoc on RCSB PDB site
Description: Crystal structure of human Smad3-FoxH1 complex
Class: transcription
Keywords: transcription factor, complex, TRANSCRIPTION
Deposited on 2017-05-27, released 2018-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mothers against decapentaplegic homolog 3
    Species: Homo sapiens [TaxId:9606]
    Gene: SMAD3, MADH3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xoca_
  • Chain 'B':
    Compound: Thioredoxin 1,Forkhead box protein H1
    Species: Homo sapiens [TaxId:9606]
    Gene: FOXH1, FAST1, FAST2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25 (Start-114)
      • linker (115-116)
    • Uniprot O75593 (117-140)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xocA (A:)
    gpdlqpvtycepafwcsisyyelnqrvgetfhasqpsmtvdgftdpsnserfclgllsnv
    nrnaaveltrrhigrgvrlyyiggevfaeclsdsaifvqspncnqrygwhpatvckippg
    cnlkifnnqefaallaqsvnqgfeavyqltrmctirmsfvkgwgaeyrrqtvtstpcwie
    lhlngplqwldkvltqmgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xocA (A:)
    lqpvtycepafwcsisyyelnqrvgetfhasqpsmtvdgftdpsnserfclgllsnvnrn
    aaveltrrhigrgvrlyyiggevfaeclsdsaifvqspncnqrygwhpatvckippgcnl
    kifnnqefaallaqsvnqgfeavyqltrmctirmsfvkgwgaeyrrqtvtstpcwielhl
    ngplqwldkvltqm
    

  • Chain 'B':
    No sequence available.