PDB entry 5xo1

View 5xo1 on RCSB PDB site
Description: Crystal structure of the isochorismatase domain of VabB from Vibrio anguillarum 775
Class: hydrolase
Keywords: VabB, isochorismatase, siderophore, iron, HYDROLASE
Deposited on 2017-05-25, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isochorismate lyase
    Species: Vibrio anguillarum 775 [TaxId:882102]
    Gene: vabB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xo1a_
  • Chain 'B':
    Compound: Isochorismate lyase
    Species: Vibrio anguillarum 775 [TaxId:882102]
    Gene: vabB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xo1b_
  • Chain 'C':
    Compound: Isochorismate lyase
    Species: Vibrio anguillarum 775 [TaxId:882102]
    Gene: vabB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xo1c_
  • Chain 'D':
    Compound: Isochorismate lyase
    Species: Vibrio anguillarum 775 [TaxId:882102]
    Gene: vabB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xo1d_
  • Chain 'E':
    Compound: Isochorismate lyase
    Species: Vibrio anguillarum 775 [TaxId:882102]
    Gene: vabB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xo1e_
  • Chain 'F':
    Compound: Isochorismate lyase
    Species: Vibrio anguillarum 775 [TaxId:882102]
    Gene: vabB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xo1f_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xo1A (A:)
    gamaipkiasysiplaetfpknkvhwhvqadravllihdmqkyfinffdhsqapvpella
    niselkslarqanipvvytaqppnqdpieralltdfwgtgltkdteivselspedgdiqy
    tkwrysafkktpllermketqrdqliivgvyahigilstaldafmldiqpfvvgdavadf
    sledhhhtlkyitervgcvtslealkpqmihsqetrlls
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xo1A (A:)
    kiasysiplaetfpknkvhwhvqadravllihdmqkyfinffdhsqapvpellaniselk
    slarqanipvvytaqppnqdpieralltdfwgtgltkdteivselspedgdiqytkwrys
    afkktpllermketqrdqliivgvyahigilstaldafmldiqpfvvgdavadfsledhh
    htlkyitervgcvtslealkpqm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xo1B (B:)
    gamaipkiasysiplaetfpknkvhwhvqadravllihdmqkyfinffdhsqapvpella
    niselkslarqanipvvytaqppnqdpieralltdfwgtgltkdteivselspedgdiqy
    tkwrysafkktpllermketqrdqliivgvyahigilstaldafmldiqpfvvgdavadf
    sledhhhtlkyitervgcvtslealkpqmihsqetrlls
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xo1B (B:)
    pkiasysiplaetfpknkvhwhvqadravllihdmqkyfinffdhsqapvpellanisel
    kslarqanipvvytaqppnqdpieralltdfwgtgltkdteivselspedgdiqytkwry
    safkktpllermketqrdqliivgvyahigilstaldafmldiqpfvvgdavadfsledh
    hhtlkyitervgcvtslealkpqm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5xo1C (C:)
    gamaipkiasysiplaetfpknkvhwhvqadravllihdmqkyfinffdhsqapvpella
    niselkslarqanipvvytaqppnqdpieralltdfwgtgltkdteivselspedgdiqy
    tkwrysafkktpllermketqrdqliivgvyahigilstaldafmldiqpfvvgdavadf
    sledhhhtlkyitervgcvtslealkpqmihsqetrlls
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xo1C (C:)
    kiasysiplaetfpknkvhwhvqadravllihdmqkyfinffdhsqapvpellaniselk
    slarqanipvvytaqppnqdpieralltdfwgtgltkdteivselspedgdiqytkwrys
    afkktpllermketqrdqliivgvyahigilstaldafmldiqpfvvgdavadfsledhh
    htlkyitervgcvtslealkpqm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5xo1D (D:)
    gamaipkiasysiplaetfpknkvhwhvqadravllihdmqkyfinffdhsqapvpella
    niselkslarqanipvvytaqppnqdpieralltdfwgtgltkdteivselspedgdiqy
    tkwrysafkktpllermketqrdqliivgvyahigilstaldafmldiqpfvvgdavadf
    sledhhhtlkyitervgcvtslealkpqmihsqetrlls
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xo1D (D:)
    aipkiasysiplaetfpknkvhwhvqadravllihdmqkyfinffdhsqapvpellanis
    elkslarqanipvvytaqppnqdpieralltdfwgtgltkdteivselspedgdiqytkw
    rysafkktpllermketqrdqliivgvyahigilstaldafmldiqpfvvgdavadfsle
    dhhhtlkyitervgcvtslealkpqm
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5xo1E (E:)
    gamaipkiasysiplaetfpknkvhwhvqadravllihdmqkyfinffdhsqapvpella
    niselkslarqanipvvytaqppnqdpieralltdfwgtgltkdteivselspedgdiqy
    tkwrysafkktpllermketqrdqliivgvyahigilstaldafmldiqpfvvgdavadf
    sledhhhtlkyitervgcvtslealkpqmihsqetrlls
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xo1E (E:)
    ipkiasysiplaetfpknkvhwhvqadravllihdmqkyfinffdhsqapvpellanise
    lkslarqanipvvytaqppnqdpieralltdfwgtgltkdteivselspedgdiqytkwr
    ysafkktpllermketqrdqliivgvyahigilstaldafmldiqpfvvgdavadfsled
    hhhtlkyitervgcvtslealkpqm
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5xo1F (F:)
    gamaipkiasysiplaetfpknkvhwhvqadravllihdmqkyfinffdhsqapvpella
    niselkslarqanipvvytaqppnqdpieralltdfwgtgltkdteivselspedgdiqy
    tkwrysafkktpllermketqrdqliivgvyahigilstaldafmldiqpfvvgdavadf
    sledhhhtlkyitervgcvtslealkpqmihsqetrlls
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xo1F (F:)
    iasysiplaetfpknkvhwhvqadravllihdmqkyfinffdhsqapvpellaniselks
    larqanipvvytaqppnqalltdfwgtgltkdteivselspedgdiqytkwrysafkktp
    llermketqrdqliivgvyahigilstaldafmldiqpfvvgdavadfsledhhhtlkyi
    tervgcvtslealkpqmi