PDB entry 5xo0

View 5xo0 on RCSB PDB site
Description: Crystal structure of the isochorismatase domain of AngB from Vibrio anguillarum 775
Class: hydrolase
Keywords: isochorismatase, DHBA, siderophore synthesis, iron metabolism, HYDROLASE
Deposited on 2017-05-25, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ischorismate lyase
    Species: Vibrio anguillarum 775 [TaxId:882102]
    Gene: G, angB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6W4P9 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d5xo0a1, d5xo0a2
  • Chain 'B':
    Compound: Ischorismate lyase
    Species: Vibrio anguillarum 775 [TaxId:882102]
    Gene: G, angB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6W4P9 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d5xo0b1, d5xo0b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xo0A (A:)
    gamaipkiasyqvlplesfptnkvdwvidpkksvvlvhdlqayflnffdktlspvpellr
    nvnkvtesarsagipvvytaqpanqdpneralltdfwgvgltqdteivpevspqpediqy
    tkwrysafkktpllewmkeeqrdqlvivgvyghigilstaldafmldikpfvigdaiadf
    skedhmntlkyvasrsgsvksvdefidsvttrsfgels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xo0A (A:)
    amaipkiasyqvlplesfptnkvdwvidpkksvvlvhdlqayflnffdktlspvpellrn
    vnkvtesarsagipvvytaqpanqdpneralltdfwgvgltqdteivpevspqpediqyt
    kwrysafkktpllewmkeeqrdqlvivgvyghigilstaldafmldikpfvigdaiadfs
    kedhmntlkyvasrsgsvksvdefidsvt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xo0B (B:)
    gamaipkiasyqvlplesfptnkvdwvidpkksvvlvhdlqayflnffdktlspvpellr
    nvnkvtesarsagipvvytaqpanqdpneralltdfwgvgltqdteivpevspqpediqy
    tkwrysafkktpllewmkeeqrdqlvivgvyghigilstaldafmldikpfvigdaiadf
    skedhmntlkyvasrsgsvksvdefidsvttrsfgels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xo0B (B:)
    amaipkiasyqvlplesfptnkvdwvidpkksvvlvhdlqayflnffdktlspvpellrn
    vnkvtesarsagipvvytaqpanqdpneralltdfwgvgltqdteivpevspqpediqyt
    kwrysafkktpllewmkeeqrdqlvivgvyghigilstaldafmldikpfvigdaiadfs
    kedhmntlkyvasrsgsvksvdefidsvt