PDB entry 5xnt

View 5xnt on RCSB PDB site
Description: Structure of CYP106A2 from Bacillus sp. PAMC 23377
Class: hydrolase
Keywords: Bacillus sp. cytochrome P450 steroid hydroxylase, HYDROLASE
Deposited on 2017-05-24, released 2018-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 CYP106
    Species: Bacillus butanolivorans [TaxId:421767]
    Database cross-references and differences (RAF-indexed):
    • PDB 5XNT (Start-410)
    Domains in SCOPe 2.07: d5xnta_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xntA (A:)
    mkeviaikeftrfktrteefspyawckrmlendpvsyhegtdtwnvfkyedvkrvlsdyk
    hfssvrkrttisvgtdseegsvpdkikiteadppehrkrrsllaaaftprslqnwepriq
    eiadelieemdeeteidivqslasplpiivmsdlmgvpskdrllfkkwvdilflpfdkek
    qeevnelkqvaakeyyqylypivvqkrlnpaddiisdllkaevdgemftddevvrttmli
    lgagvettshllansfysllyddkevyqelhenldlvpqaveemlryrfnlikldrtvke
    dndllgvelkegenvvvwmsaanldeemfedaftlnihrpnnkkhltfgngphfclgapl
    arleakialttflkkfkhieavpsfqlednltdsatgqtltslplkacrtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xntA (A:)
    ikeftrfktrteefspyawckrmlendpvsyhegtdtwnvfkyedvkrvlsdykhfssvr
    ksvpdkikiteadppehrkrrsllaaaftprslqnwepriqeiadelieemdeeteidiv
    qslasplpiivmsdlmgvpskdrllfkkwvdilflpfdkekqeevnelkqvaakeyyqyl
    ypivvqkrlnpaddiisdllkaevdgemftddevvrttmlilgagvettshllansfysl
    lyddkevyqelhenldlvpqaveemlryrfnlikldrtvkedndllgvelkegenvvvwm
    saanldeemfedaftlnihrpnnkkhltfgngphfclgaplarleakialttflkkfkhi
    eavpsfqlednltdsatgqtltslplkacrtl