PDB entry 5xne

View 5xne on RCSB PDB site
Description: X-ray Crystal Structure of alpha-acetolactate decarboxylase from Bacillus subtilis strain 168
Class: lyase
Keywords: Acetolactate decarboxylase, LYASE
Deposited on 2017-05-22, released 2018-08-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-acetolactate decarboxylase
    Species: Bacillus subtilis subsp. subtilis str. 168 [TaxId:224308]
    Gene: alsD, BSU36000
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5xnea_
  • Chain 'B':
    Compound: alpha-acetolactate decarboxylase
    Species: Bacillus subtilis subsp. subtilis str. 168 [TaxId:224308]
    Gene: alsD, BSU36000
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5xneb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xneA (A:)
    vsqiyqvstmtslldgvydgdfelseipkygdfgigtfnkldgeligfdgefyrlrsdgt
    atpvqngdrspfcsftfftpdmthkidakmtredfekeinsmlpsrnlfyairidglfkk
    vqtrtvelqekpyvpmveavktqpifnfdnvrgtivgfltpayangiavsgyhlhfideg
    rnsgghvfdyvledctvtisqkmnmnlrlpntadffnanldnpdfakdiettegs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xneB (B:)
    vsqiyqvstmtslldgvydgdfelseipkygdfgigtfnkldgeligfdgefyrlrsdgt
    atpvqngdrspfcsftfftpdmthkidakmtredfekeinsmlpsrnlfyairidglfkk
    vqtrtvelqekpyvpmveavktqpifnfdnvrgtivgfltpayangiavsgyhlhfideg
    rnsgghvfdyvledctvtisqkmnmnlrlpntadffnanldnpdfakdiettegs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xneB (B:)
    sqiyqvstmtslldgvydgdfelseipkygdfgigtfnkldgeligfdgefyrlrsdgta
    tpvqngdrspfcsftfftpdmthkidakmtredfekeinsmlpsrnlfyairidglfkkv
    qtrtvelqekpyvpmveavktqpifnfdnvrgtivgfltpayangiavsgyhlhfidegr
    nsgghvfdyvledctvtisqkmnmnlrlpntadffnanldnpdfakdiettegs